Recombinant Human Elongation of very long chain fatty acids protein 3 (ELOVL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human ELOVL3

Recombinant Human ELOVL3 (Elongation of Very Long Chain Fatty Acids Protein 3) is a synthetic version of the endogenous ELOVL3 enzyme, produced via recombinant DNA technology in E. coli systems . This protein belongs to the GNS1/SUR4 family and catalyzes the first and rate-limiting step in the elongation cycle of long-chain fatty acids (LCFAs), extending saturated/monounsaturated acyl-CoAs (C16–C18) into very long-chain fatty acids (VLCFAs, C20–C24) . Recombinant ELOVL3 is critical for studying lipid metabolism, cellular proliferation, and disease mechanisms, particularly in adipogenesis, liver regeneration, and retinal function .

Biochemical Characteristics

Recombinant ELOVL3 is engineered with specific modifications for stability and functionality. Key features include:

ParameterDetails
Expression SystemE. coli (PET28a vector with N-terminal 6×His tag)
Molecular Weight~30 kDa (predicted from amino acid sequence)
Amino Acid SequenceContains residues 1–141 (partial sequence: DTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGG...)
Post-Translational ModificationsNot explicitly reported; endogenous ELOVL3 is membrane-bound and may require lipid modifications for activity .

Functional Role and Enzymatic Activity

Recombinant ELOVL3 replicates the endogenous enzyme’s role in VLCFA biosynthesis, influencing lipid homeostasis and cellular signaling.

Enzymatic Activity

ELOVL3 acts as a 3-ketoacyl-CoA synthase, condensing malonyl-CoA with acyl-CoA substrates to elongate fatty acid chains . Key substrates and products include:

SubstrateProductBiological Relevance
C18:0 acyl-CoAC20:0 acyl-CoAPrecursor for membrane lipids and ceramides
C18:1 acyl-CoAC20:1 acyl-CoAActivates PPARγ in adipocytes
C24–C26 saturated FAC26–C28 saturated FARetinal VLC-PUFA synthesis

ELOVL3 exhibits higher activity toward C18:0 acyl-CoAs, with lower efficiency for polyunsaturated substrates .

Applications in Research

Recombinant ELOVL3 is utilized in diverse experimental contexts:

ApplicationMethodologyOutcome
ImmunohistochemistryAntibodies targeting ELOVL3 (e.g., ab253016) detect protein in human tissues .Localizes ELOVL3 in skin, liver, and adipose tissue; absent in pancreas and tonsil controls .
Blocking AssaysRecombinant protein (Ag13675) used to inhibit ELOVL3 interactions .Validates antibody specificity or disrupts enzymatic activity in vitro.
Adipogenesis StudiesForced expression in 3T3-L1 cells to study PPARγ activation .Reduces cell proliferation and triglyceride accumulation; stalls S-phase .

Liver Regeneration and Proliferation

  • Zhx2 Regulation: Zhx2 transcriptionally activates Elovl3 in the liver. During regeneration, Elovl3 expression drops, correlating with reduced VLCFAs and impaired cell cycle progression .

  • Cell Cycle Impact: Forced Elovl3 expression stalls hepatoma cells in S-phase, reducing cyclin D/A/E mRNA levels .

Adipogenesis and PPARγ Activation

  • PPARγ-ELOVL3 Cascade: Elovl3 expression peaks during adipocyte differentiation, driven by PPARγ. C18:1/C20:1 VLCFAs produced by ELOVL3 act as endogenous PPARγ agonists, enhancing triglyceride storage and adipogenic gene expression (e.g., aP2, SCD) .

  • siRNA Knockdown: Reduces triglycerides by 47% and suppresses lipogenic/lipolytic genes (e.g., ACC, FAS, ATGL) .

Retinal VLC-PUFA Biosynthesis

  • ELOVL3 vs. ELOVL4: While Elovl3 elongates saturated VLCFAs, Elovl4 synthesizes polyunsaturated VLC-PUFAs (e.g., C26–C34) critical for retinal membrane structure .

Clinical and Therapeutic Implications

  • Metabolic Disorders: Dysregulated ELOVL3 may contribute to obesity/diabetes. VLCFAs enhance PPARγ signaling, suggesting therapeutic potential .

  • Liver Diseases: Suppressed Elovl3 in regenerating livers correlates with altered lipid profiles, implicating VLCFAs in hepatocyte proliferation .

  • Retinal Health: VLC-PUFAs, influenced by ELOVL3/4, are essential for photoreceptor integrity; disruptions may link to diseases like Stargardt’s .

Production and Handling

Recombinant ELOVL3 requires careful handling to maintain activity:

ParameterRecommendation
StorageLyophilized protein stored at -20°C; avoid repeated freeze-thaw cycles .
DilutionUse in PBS or blocking buffer (e.g., 4 μg/ml for ICC/IF, 1/2500 for IHC-P) .
StabilityShort-term storage at +4°C; aliquot upon delivery .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ELOVL3; CIG30; Elongation of very long chain fatty acids protein 3; 3-keto acyl-CoA synthase ELOVL3; Cold-inducible glycoprotein of 30 kDa; ELOVL fatty acid elongase 3; ELOVL FA elongase 3; Very long chain 3-ketoacyl-CoA synthase 3; Very long chain 3-oxoacyl-CoA synthase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ELOVL3
Target Protein Sequence
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKG FNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVF LLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAI MYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSF ILYMTYFILFAHFFCQTYIRPKVKAKTKSQ
Uniprot No.

Target Background

Function
ELOVL3 catalyzes the first and rate-limiting step in the four-reaction elongation cycle for long-chain fatty acids. This endoplasmic reticulum-bound enzymatic process allows the addition of two carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. This condensing enzyme exhibits activity toward saturated and unsaturated acyl-CoA substrates, with higher activity toward C18 acyl-CoAs, particularly C18:0 acyl-CoAs. ELOVL3 may play a role in the production of saturated and monounsaturated VLCFAs of various chain lengths, which are involved in numerous biological processes as precursors of membrane lipids and lipid mediators.
Database Links

HGNC: 18047

OMIM: 611815

KEGG: hsa:83401

STRING: 9606.ENSP00000359022

UniGene: Hs.302130

Protein Families
ELO family, ELOVL3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Testis.

Q&A

Basic Research Questions

  • What is ELOVL3 and what is its primary function in cellular metabolism?

    ELOVL3 (Elongation of Very Long Chain Fatty Acids Protein 3) belongs to a family of genes (ELOVL 1-7) encoding enzymes that synthesize very long chain fatty acids (VLCFAs) . It catalyzes the first and rate-limiting reaction of the four reactions constituting the long-chain fatty acids elongation cycle . This endoplasmic reticulum-bound enzymatic process enables the addition of 2 carbon atoms to long- and very long-chain fatty acids per cycle . ELOVL3 specifically synthesizes C20-C24 saturated and monounsaturated fatty acids, exhibiting higher activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs .

    The VLCFAs produced by ELOVL3 are commonly incorporated into ceramides or metabolized to lipid mediators that regulate cellular growth, differentiation, proliferation, and other physiological functions . These fatty acids serve as precursors of membrane lipids and bioactive lipid mediators involved in multiple biological processes .

  • Where is ELOVL3 primarily expressed in human and animal tissues?

    ELOVL3 is expressed primarily in brown and white adipose tissue, skin sebaceous glands, and the liver . Its expression pattern varies developmentally, with extremely low expression in embryonic livers that increases postnatally . In mice, ELOVL3 exhibits sex-specific expression patterns, with male-biased expression becoming apparent between 4 and 8 weeks of age .

    Tissue/ConditionELOVL3 Expression LevelSource
    Brown adipose tissueHigh
    White adipose tissueHigh
    Skin sebaceous glandsHigh
    Liver (adult)High
    Liver (embryonic)Extremely low
    Male liver (mature)Higher than female
    Female liver (early development)Higher than male
    Regenerating liverDramatically decreased
  • How is ELOVL3 expression regulated at the transcriptional level?

    ELOVL3 expression is regulated by multiple transcription factors and signaling pathways:

    • ZHX2 (Zinc fingers and homeoboxes 2) acts as a transcriptional activator of hepatic ELOVL3 expression

    • Tumor suppressor p53 transcriptionally activates ELOVL3, connecting it to cell cycle regulation

    • Sex hormones significantly influence ELOVL3 expression, with androgens required for male-biased hepatic expression

    • Androgen receptor (AR) targets the ELOVL3 promoter and inhibits its transcriptional activity

    • Estrogen receptor signaling appears to maintain lower mRNA levels of ELOVL3 in female mice and cells

    Microarray data from BALB/cJ mice (carrying a natural hypomorphic mutation in ZHX2) showed a positive correlation between ZHX2 and ELOVL3 expression levels . Studies using ChIP assays have confirmed that ZHX2 directly binds the ELOVL3 promoter and an upstream DHS to regulate transcription .

  • What is the relationship between ELOVL3 and cell cycle regulation?

    ELOVL3 appears to function as a negative regulator of cell proliferation. Evidence supporting this includes:

    • ELOVL3 mRNA levels are extremely low in embryonic livers, increase postnatally, and decrease dramatically during liver regeneration

    • Overexpression of ELOVL3 slows the in vitro growth of Huh7 cells and stalls HeLa cell cycle progression in S-phase

    • Forced ELOVL3 expression results in significant reductions in Cyclins D, A, and E, which are key regulators of cell cycle progression

    • ELOVL3 is transcriptionally activated by p53, a well-established tumor suppressor involved in cell cycle arrest

    • VLCFAs synthesized by ELOVL3 are often incorporated into ceramides, which are effective tumor suppressors that induce apoptosis and reduce proliferation through cell cycle arrest

  • What are the known alternative names and protein characteristics of ELOVL3?

    ELOVL3 is also known by several alternative names:

    • CIG30 (Cold-inducible glycoprotein of 30 kDa)

    • 3-keto acyl-CoA synthase ELOVL3

    • ELOVL fatty acid elongase 3

    • Very long chain 3-ketoacyl-CoA synthase 3

    • Very long chain 3-oxoacyl-CoA synthase 3

    The human ELOVL3 protein functions as a condensing enzyme that exhibits activity toward saturated and unsaturated acyl-CoA substrates . Commercial antibodies against ELOVL3 are available for techniques including immunohistochemistry (IHC-P) and immunocytochemistry/immunofluorescence (ICC/IF) .

Advanced Research Questions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.