Recombinant Human Elongation of very long chain fatty acids protein 4 (ELOVL4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Metabolism

ELOVL4 catalyzes the rate-limiting condensation step in fatty acid elongation cycles, enabling:

Key enzymatic actions:

  • Conversion of C26 saturated fatty acids (e.g., 26:0) to C28-C38 products

    • In ARPE-19 cells: 77% increase in 28:0 synthesis vs. 11-12% in controls

    • In cardiomyocytes: 79% elevation in 28:0 production

  • Biosynthesis of very long chain polyunsaturated fatty acids (VLC-PUFAs ≥C28)

Substrate specificity:

SubstrateProductTissue Relevance
24:0 → 26:0Not catalyzedBaseline elongation
26:0 → 28:0Primary activityRetina, brain, skin
28:0 → 30:0Secondary activityPhotoreceptor membranes

Research Findings from Model Systems

Cellular studies:

  • Overexpression in ARPE-19 cells increased VLC-PUFA (C28-C38) synthesis by 3.8-fold compared to endogenous levels

  • Co-expression with mutant ELOVL4 (STGD3 variants) caused:

    • Aggresome formation in 89% of transfected HEK293T cells

    • 62% reduction in wild-type ELOVL4 ER retention

Animal models:

ModelPhenotypeVLC-FA Reduction
Elovl4 KO miceNeonatal lethality (skin barrier defects)98% in epidermis
Photoreceptor cKO40-55% loss of retinal VLC-PUFAsLipofuscin accumulation

Disease Associations

Stargardt macular dystrophy (STGD3):

  • Truncated ELOVL4 mutants (e.g., 5-bp deletion) disrupt ER localization:

    • 72% mislocalization to cytoplasm in COS-7 cells

    • Dominant-negative inhibition of wild-type enzyme activity

Neurocutaneous syndromes:

  • Recessive mutations cause:

    • 94% decrease in brain sphingolipids

    • Seizures and intellectual disability in 100% of reported cases

Research Applications

Experimental uses:

  • Functional assays for fatty acid elongation kinetics

  • Antibody production targeting catalytic domains

  • Structure-function studies of ER retention motifs

Technical limitations:

  • Partial fragment lacks transmembrane domains (residues 155-314 missing)

  • No demonstrated activity in in vitro elongation assays without full-length protein context

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the protein's intrinsic stability. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ELOVL4; Elongation of very long chain fatty acids protein 4; 3-keto acyl-CoA synthase ELOVL4; ELOVL fatty acid elongase 4; ELOVL FA elongase 4; Very long chain 3-ketoacyl-CoA synthase 4; Very long chain 3-oxoacyl-CoA synthase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ELOVL4
Target Protein Sequence
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRELFMGSYNAGYSYICQSVDYSNNVH EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQLNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKAGKTAMNGISANGVSKSEKQLMI ENGKKQKNGKAKGD
Uniprot No.

Target Background

Function
ELOVL4 catalyzes the first and rate-limiting step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzymatic process enables the addition of two carbons per cycle to the chains of long- and very long-chain fatty acids (VLCFAs). ELOVL4 acts as a condensing enzyme, catalyzing the synthesis of very long-chain saturated (VLC-SFA) and polyunsaturated (PUFA) fatty acids, which are essential components in various biological processes. These fatty acids serve as precursors for membrane lipids and lipid mediators and may play a critical role in early brain and skin development.
Gene References Into Functions
  1. A significant reduction in ELOVL4 promoter activity was observed due to the combination of two variants. Diminished ELOVL4 enzymatic activity could lead to a deficiency of VLC-PUFA, essential components for rod function and longevity, contributing to the pathogenesis of Stargardt disease. PMID: 29417145
  2. Normalizing retinal ELOVL4 expression could prevent blood-retinal barrier dysregulation in diabetic retinopathy by increasing very long-chain ceramides and stabilizing tight junctions. PMID: 29362226
  3. Swiss families with dominant Stargardt disease are often caused by a recurring mutation in the ELOVL4 gene. PMID: 27116512
  4. In various ethnicities, STGD patients may carry distinct ELOVL4 and PRPH2 sequence variants. The genetic variations identified in this study might be related to STGD etiopathogenesis. PMID: 27813578
  5. In patients with intrahepatic cholestasis of pregnancy, no elevation in ELOVL4 mRNA was detected in maternal circulation compared to controls. PMID: 25059952
  6. Both ELOVL4- and PROM1-related maculopathies are characterized by progressive photoreceptor atrophy and central vision loss. Advanced diagnostic imaging can identify early disease changes and track disease progression. PMID: 26110599
  7. Different mutations in ELOVL4 can cause variable phenotypic neurological disorders (Review). PMID: 26427403
  8. Spinocerebellar ataxia was associated with a novel mutation in ELOVL4 in a large family pedigree. PMID: 26010696
  9. This review summarizes the current understanding of disease-causing mutations in ELOVL4 and their potential role in STGD3 pathogenesis. PMID: 24664730
  10. Transgenic expression of ELOVL4 in the liver is predicted to result in the biosynthesis of very long-chain PUFA that can be transported to target tissues. PMID: 24664752
  11. ELOVL4 is identified as the causative gene for erythrokeratodermia variabilis and spinocerebellar ataxia in a French-Canadian family. PMID: 24566826
  12. A novel homozygous nonsense mutation in ELOVL4 causes a neuro-ichthyotic disorder with varying expressivity. PMID: 24571530
  13. Coexpression of various wild-type and mutant ELOVL4 forms revealed a significant dominant-negative effect of mutant protein on ELOVL4 localization and enzymatic activity, leading to reduced VLC-PUFA synthesis. PMID: 23509295
  14. Five single nucleotide polymorphisms (SNPs: rs3812153, rs7764439, rs390659, rs434102 and c:929G>A) were detected in ELOVL4. PMID: 22948568
  15. Mutations in the ELOVL4 gene are associated with Stargardt Disease. PMID: 22863181
  16. Recessive retinitis pigmentosa and Leber congenital amaurosis are rarely, if ever, associated with changes in the ELOVL4 gene. PMID: 22100072
  17. Not only the ELOVL4-ELOVL4DeltaC homo-oligomeric interaction, but also several hetero-oligomeric interactions, might contribute to the pathology of Stargardt disease 3. PMID: 21139992
  18. No association was found between the M299V variant in the ELOVL4 gene and exudative age-related macular degeneration in a Chinese population. PMID: 20388345
  19. Pathogenic mutations identified in the ELOVL4 gene result in altered protein trafficking and exhibit a dominant-negative effect. PMID: 20096366
  20. The ELOVL4 gene is highly conserved throughout evolution and is expressed in the photoreceptor cells of the retina in various species. PMID: 12824221
  21. DNA sequence analysis revealed a 5-bp deletion in exon 6 of the ELOVL4 gene, confirming the diagnosis of autosomal dominant Stargardt-like macular dystrophy. PMID: 12967813
  22. Mutations in ELOVL4 lead to intracellular misrouting of the protein in macular degeneration. PMID: 15028284
  23. ELOVL4 contributes to the autosomal dominant inheritance of Stargardt-like macular dystrophy. PMID: 16036915
  24. Analysis of non-pathogenic polymorphisms in ELOVL4 was conducted in Chinese patients with autosomal dominant STGD3-like macular dystrophy. PMID: 16364203
  25. This study demonstrates that dietary factors can influence the severity of inherited human macular dystrophy. PMID: 16476896
  26. No association with AMD was detected with the Met299Val polymorphism in the ELOVL4 gene in familial or sporadic cases compared to non-AMD or blood donor controls. PMID: 16885922
  27. ELOVL4 plays a role in acylceramide synthesis, particularly in the synthesis of unique very long-chain C30-C40 fatty acids present in skin acylceramides. PMID: 17356513
  28. Mutational analysis indicates that ELOVL4 is not involved in the pathogenesis of RP25. PMID: 11474659

Show More

Hide All

Database Links

HGNC: 14415

OMIM: 133190

KEGG: hsa:6785

STRING: 9606.ENSP00000358831

UniGene: Hs.101915

Involvement In Disease
Stargardt disease 3 (STGD3); Ichthyosis, spastic quadriplegia, and mental retardation (ISQMR); Spinocerebellar ataxia 34 (SCA34)
Protein Families
ELO family, ELOVL4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the retina and at much lower level in the brain. Ubiquitous, highest expression in thymus, followed by testis, small intestine, ovary, and prostate. Little or no expression in heart, lung, liver, or leukocates.

Q&A

What is the molecular structure of ELOVL4 and how does it relate to its enzymatic function?

ELOVL4 is a transmembrane protein located in the endoplasmic reticulum with a predicted molecular weight of 36.8 kDa containing 314 amino acids . Research suggests two possible topological models for ELOVL4:

  • A five transmembrane-spanning topology

  • A seven transmembrane-spanning topology

The protein contains critical functional domains:

  • A catalytic histidine core essential for enzymatic activity

  • An ER retention/retrieval signal (KXKXX) at the C-terminus required for localization

  • N-glycosylation consensus motifs that do not affect enzymatic function

Methodological approach: To study ELOVL4 structure-function relationships, researchers should use site-directed mutagenesis targeting the histidine core and ER retention signal, followed by activity assays and subcellular localization studies. Expression systems should maintain the protein within the ER membrane to preserve enzymatic function.

Which fatty acid substrates does ELOVL4 specifically elongate?

ELOVL4 demonstrates specific substrate selectivity:

Substrate TypeExamplesProductsChain Length
Long-chain PUFA20:5n3 (EPA), 22:5n3 (DPA)VLC-PUFAC28-C38
Long-chain SFA26:0VLC-SFAC28-C38

Unlike other elongases, ELOVL4 specifically catalyzes the elongation of:

  • 20:5n3 (eicosapentaenoic acid, EPA) and 22:5n3 (docosapentaenoic acid, DPA) to VLC-PUFA with chain lengths ≥28 carbons

  • 26:0 to VLC-SFA (28:0, 30:0, and longer)

Notably, ELOVL4 does not participate in DHA (22:6n3) biosynthesis , which has significant implications for therapeutic approaches to ELOVL4-related disorders.

Methodological approach: For substrate specificity studies, use recombinant ELOVL4 expression systems combined with LC-MS/MS analysis of elongation products. EPA is preferred over AA (20:4n6) and DHA as a substrate for VLC-PUFA formation .

How does ELOVL4 expression differ across tissues, and what methods are most effective for studying tissue-specific functions?

ELOVL4 demonstrates distinct tissue-specific expression patterns correlating with unique fatty acid profiles:

TissuePrimary ProductsAssociated Functions
RetinaVLC-PUFAPhotoreceptor function, prevention of macular degeneration
BrainVLC-SFA (28:0, 30:0)Synaptic signaling, neuronal survival
SkinVLC-SFAPermeability barrier maintenance
Meibomian glandsVLC-FATear film integrity
Testes/SpermVLC-PUFASperm function and fertility

In the retina, ELOVL4 is highly enriched in rod and cone photoreceptors, specifically concentrated in photoreceptor inner segments . This tissue-specific localization corresponds with the high levels of VLC-PUFA-containing glycerophospholipids in the retina .

Methodological approach: For tissue-specific functional studies, researchers should:

  • Generate tissue-specific conditional knockout models (e.g., photoreceptor-specific Elovl4 knockout mice )

  • Use high-performance liquid chromatography-mass spectrometry (HPLC-MS) to analyze fatty acid composition of membrane glycerophospholipids

  • Combine histological, immunofluorescent, and electrophysiological assessments to correlate structural and functional changes

What are the specific functions of VLC-PUFA and VLC-SFA in different tissues?

The tissue-specific functions of ELOVL4 products demonstrate their essential roles:

VLC-PUFA Functions:

  • Retina: Essential for retinal function through formation of bioactive "Elovanoids"

  • Sperm: Critical for fertility and sperm function

VLC-SFA Functions:

  • Brain: Enriched in synaptic vesicles where they mediate neuronal signaling by determining neurotransmitter release rates

  • Skin: Maintain permeability barrier function through specialized lipid structures

Methodological approach: To investigate tissue-specific functions, researchers should employ:

  • Lipidomic profiling using LC-MS/MS to characterize VLC-FA distributions

  • Electrophysiology to assess synaptic function in VLC-SFA-enriched neurons

  • Barrier function assays in skin models lacking VLC-SFA

What is the catalytic mechanism of ELOVL4 in fatty acid elongation?

ELOVL4 catalyzes the initial, rate-limiting condensation reaction in the four-step fatty acid elongation cycle:

  • Condensation: ELOVL4 catalyzes the condensation between an acyl-CoA and malonyl-CoA, producing a 3-ketoacyl-CoA (rate-limiting step)

  • Reduction: 3-ketoacyl-CoA reductase (KAR) reduces the ketone group

  • Dehydration: 3-hydroxyacyl-CoA dehydratases (HACD1-4) remove water

  • Reduction: Trans-2,3-enoyl-CoA reductase (TER) performs the final reduction

The elongation proceeds via an acyl-enzyme intermediate involving the second histidine in the canonical HxxHH motif, as demonstrated for the ELOVL family .

Methodological approach: To study the catalytic mechanism:

  • Perform site-directed mutagenesis of the conserved histidine residues in the HxxHH motif

  • Use cell-free microsomal assays to assess enzymatic activity

  • Employ radiolabeled substrates to track intermediates in the elongation process

How do ELOVL4 protein-protein interactions affect its enzymatic activity?

ELOVL4 forms both homo-oligomeric and hetero-oligomeric complexes that significantly impact its function:

  • Homodimers: ELOVL4 can form homodimers; mutant and wild-type ELOVL4 dimerization leads to mislocalization away from the ER

  • Hetero-oligomers: ELOVL4 can complex with other ELOVL family members and VLC-FA-associated enzymes

  • Dominant negative effects: Mutant ELOVL4 forms interact more strongly with other elongases and enzymes than wild-type ELOVL4, potentially affecting synthesis of multiple fatty acid species

Methodological approach: To investigate protein-protein interactions:

  • Use co-immunoprecipitation and proximity ligation assays to detect interacting partners

  • Employ bimolecular fluorescence complementation to visualize interactions in living cells

  • Assess enzymatic activity in reconstituted systems with purified components

How do different ELOVL4 mutations lead to distinct tissue-specific pathologies?

Different mutations in the ELOVL4 gene cause remarkably distinct tissue-specific disorders:

Mutation TypeDiseaseAffected TissueMolecular Mechanism
5-bp deletion (797–801_delAACTT) in exon 6STGD3 (Stargardt-like macular dystrophy)RetinaLoss of ER retention signal → mislocalization + dominant negative effect
Point mutations (e.g., L168F, W246G)SCA34 (Spinocerebellar Ataxia-34)Brain/CerebellumAltered VLC-PUFA/VLC-SFA ratio
Point mutationsErythrokeratodermia variabilisSkinImpaired VLC-SFA synthesis
Homozygous variantsNeuro-ichthyotic syndromeBrain/SkinSevere deficiency in both VLC-PUFA and VLC-SFA

The W246G mutation shows dramatically impaired VLC-SFA synthesis with partially preserved VLC-PUFA synthesis, while L168F exhibits a gain of function in certain VLC-PUFA species (38:5n3) but reduced VLC-SFA production .

Methodological approach: To study mutation-specific effects:

  • Generate cell models expressing specific ELOVL4 mutations using CRISPR/Cas9

  • Compare lipidomic profiles across mutation types

  • Assess protein localization using immunofluorescence

  • Measure enzymatic activity for both VLC-PUFA and VLC-SFA synthesis

What are the cellular consequences of ELOVL4 mutations in photoreceptors?

The cellular pathology in STGD3 involves multiple mechanisms:

  • Protein mislocalization: Truncated ELOVL4 lacking the ER retention signal is mislocalized from the ER to Golgi in photoreceptors

  • Aggregate formation: Mutant ELOVL4 forms aggregates in the endoplasmic reticulum of photoreceptors

  • Dominant negative effects: Mutant ELOVL4 downregulates wild-type ELOVL4 function, reducing VLC-PUFA synthesis

  • Enzymatic inactivity: The 5-bp deletion mutant ELOVL4 lacks all innate condensation activity

  • VLC-PUFA depletion: Progressive loss of retinal VLC-PUFA contributes to photoreceptor degeneration

Methodological approach: To investigate cellular consequences:

  • Use photoreceptor-specific conditional knockout models

  • Perform electron microscopy to visualize ultrastructural changes

  • Employ live cell imaging to track protein aggregation

  • Use electrophysiology to assess functional changes preceding cell death

How can recombinant ELOVL4 be optimally expressed and purified for in vitro studies?

Expressing functional ELOVL4 presents unique challenges due to its transmembrane nature:

Expression system optimization:

  • Recombinant adenovirus approach: Use recombinant adenovirus type 5 viral particles carrying the mouse Elovl4 minigene for expression in model cell lines such as ARPE-19 cells

  • Membrane protein considerations: ELOVL4 requires proper ER membrane integration for activity; detergent selection is critical during purification

  • Functional assessment: Validate activity using microsomal assays with radiolabeled substrates

Methodological approach: A comprehensive protocol should include:

  • Clone human ELOVL4 cDNA into expression vectors with appropriate tags

  • Express in eukaryotic systems that maintain ER structure (HEK293, CHO, ARPE-19 cells)

  • Prepare microsomes for functional studies rather than attempting complete purification

  • Validate using LC-MS/MS detection of elongation products

What experimental approaches can distinguish between VLC-PUFA and VLC-SFA production in different tissue contexts?

Differential analysis of VLC-PUFA and VLC-SFA production requires sophisticated methodologies:

Analytical approaches:

  • HPLC-MS techniques: High-performance liquid chromatography coupled with mass spectrometry allows specific identification of VLC-PUFA and VLC-SFA species

  • Tissue-specific isotope labeling: Use tissue-specific expression of mutant ELOVL4 variants with differential activity (e.g., W246G which selectively impairs VLC-SFA synthesis)

  • Substrate manipulation: Supply specific precursors (EPA vs. 26:0) to analyze pathway-specific outputs

Methodological approach:

  • Extract total lipids using modified Bligh and Dyer methods

  • Perform fatty acid methyl ester (FAME) derivatization

  • Use LC-MS/MS with multiple reaction monitoring for chain length and saturation specificity

  • Incorporate internal standards for absolute quantification

How do ELOVL4-derived VLC-PUFAs and VLC-SFAs specifically influence synaptic function?

Recent research reveals distinct mechanisms for VLC-PUFA and VLC-SFA in synaptic function:

VLC-PUFA in retinal synapses:

  • Form bioactive "Elovanoids" that promote photoreceptor and retinal pigment epithelium cell survival

  • Contribute to specialized membrane microdomains in photoreceptor terminals

VLC-SFA in brain synapses:

  • Enriched in synaptic vesicles

  • Regulate neurotransmitter release rate

  • Affect synaptic vesicle fusion kinetics through membrane biophysical properties

Methodological approach: To investigate synaptic functions:

  • Use electrophysiology to measure synaptic transmission in tissue-specific Elovl4 knockout models

  • Perform electron microscopy to assess synaptic vesicle morphology and distribution

  • Use optical methods (SynaptoZip, SynTagMA) to monitor vesicle fusion events in real-time

  • Employ lipidomic analysis of isolated synaptic vesicle fractions

What strategies might restore ELOVL4 function or compensate for its loss in disease states?

Potential therapeutic approaches targeting ELOVL4-related disorders include:

  • Gene therapy approaches:

    • AAV-mediated delivery of wild-type ELOVL4 to affected tissues

    • CRISPR/Cas9-based correction of specific mutations

  • Small molecule screening:

    • Compounds that promote proper folding and localization of mutant ELOVL4

    • Drugs that enhance remaining ELOVL4 activity in heterozygous conditions

  • Dietary supplementation strategies:

    • Direct supplementation with VLC-PUFA or VLC-SFA (limited by blood-brain/retinal barriers)

    • Note: DHA supplementation alone is ineffective for STGD3, as clinical trials (650 mg EPA + 350 mg DHA daily) did not attenuate maculopathy progression

Methodological approach: To develop therapeutic strategies:

  • Test gene therapy constructs in animal models of ELOVL4-related diseases

  • Develop high-throughput screens for compounds that rescue mutant ELOVL4 localization

  • Explore nanoparticle-based delivery of synthetic VLC-PUFAs/VLC-SFAs

How might manipulation of ELOVL4 activity impact broader metabolic pathways?

Modulating ELOVL4 activity could have extensive metabolic consequences:

  • Intersection with other elongase pathways:

    • Given ELOVL4's interactions with other elongases, its manipulation may affect broad lipid metabolism

    • ELOVL4 inhibition affects AMP-activated protein kinase (AMPK) signaling

  • Oxidative stress responses:

    • ELOVL4 inhibition leads to reactive oxygen species (ROS) production

    • Altered ELOVL4 activity influences the unfolded protein response (UPR)

  • Transcriptional regulation:

    • ELOVL4 inhibition robustly induces Krüppel-like factor 4 (KLF4) expression

    • KLF4 acts as a downstream target of AMPK in regulating vascular smooth muscle cell phenotype

Methodological approach: To investigate metabolic consequences:

  • Perform RNA-seq analysis on tissues with modulated ELOVL4 activity

  • Use metabolomics to assess broader lipid metabolism changes

  • Analyze signaling pathway activation with phospho-specific antibodies

  • Investigate transcription factor binding using ChIP-seq

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.