Recombinant Human Elongation of very long chain fatty acids protein 6 (ELOVL6)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Lipid Metabolism

ELOVL6 coordinates with other elongases (e.g., ELOVL3, ELOVL4) to regulate fatty acid chain elongation, a process integral to membrane lipid synthesis and ceramide production .

Key Interactions

ELOVL6 interacts with enzymes and transcription factors involved in lipid homeostasis:

PartnerFunctionInteraction ScoreSource
SCD (Stearoyl-CoA Desaturase)Converts saturated fatty acids to monounsaturated fatty acids (e.g., palmitate → palmitoleate)0.984
TECR (Trans-2,3-enoyl-CoA Reductase)Catalyzes the final reduction step in fatty acid elongation0.973
SREBF1/2 (Sterol Regulatory Element-Binding Proteins)Transcriptionally regulates fatty acid synthesis pathways0.927–0.921

Role in Disease Pathogenesis and Therapeutic Targets

ELOVL6 dysregulation is implicated in metabolic, vascular, and neurodegenerative diseases.

Metabolic Diseases

  • Insulin Resistance: ELOVL6 knockout (Elovl6⁻/⁻) mice show improved hepatic insulin sensitivity despite obesity, linked to reduced palmitate accumulation and AMPK activation .

  • Non-Alcoholic Steatohepatitis (NASH): ELOVL6 deficiency reduces lipid accumulation and inflammation in liver tissues .

Vascular Pathologies

  • Atherosclerosis and Restenosis: ELOVL6 inhibition suppresses vascular smooth muscle cell (VSMC) proliferation via AMPK/KLF4 signaling, reducing neointima formation .

Neurodegenerative Disorders

  • Multiple Sclerosis (MS): ELOVL6 upregulation in foamy macrophages exacerbates demyelination. Its deletion enhances remyelination by promoting lipid efflux and neurotrophic factor production .

Therapeutic Applications and Research Findings

Recombinant ELOVL6 is used to study lipid metabolism in vitro and in vivo.

Experimental Models

ModelObservationSource
Elovl6⁻/⁻ MiceReduced stearate (C18:0) and oleate (C18:1n-9) levels; improved insulin sensitivity ,
Cuprizone-Induced DemyelinationELOVL6 deficiency enhances remyelination and reduces lipid accumulation in brain ,
VSMC KnockdownInhibited PDGF-BB-induced proliferation; increased ROS and AMPK activity ,

Mechanistic Insights

  • Lipid Composition Shifts: ELOVL6 inhibition elevates palmitate (C16:0) and reduces oleate (C18:1n-9), altering cellular energy balance .

  • Signaling Pathways:

    • AMPK Activation: Increased palmitate triggers ROS production, activating AMPK, which upregulates KLF4 to suppress VSMC proliferation .

    • S1P/PPARγ Pathway: ELOVL6 deficiency enhances sphingosine 1-phosphate (S1P) signaling, promoting phagocyte-mediated lipid efflux in MS models .

Research and Diagnostic Tools

Recombinant ELOVL6 is utilized in:

  • Immunohistochemistry (IHC): Detects ELOVL6 expression in human liver and brain tissues .

  • Enzymatic Assays: Measures elongation activity in vitro (e.g., conversion of C16:0 to C18:0) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a particular tag type.
Synonyms
ELOVL6; FACE; LCE; Elongation of very long chain fatty acids protein 6; 3-keto acyl-CoA synthase ELOVL6; ELOVL fatty acid elongase 6; ELOVL FA elongase 6; Fatty acid elongase 2; hELO2; Fatty acyl-CoA elongase; Long-chain fatty-acyl elongase; Very long chain 3-ketoacyl-CoA synthase 6; Very long chain 3-oxoacyl-CoA synthase 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ELOVL6
Target Protein Sequence
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR KPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSK APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY YALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYL SYLVLFCHFFFEAYIGKMRKTTKAE
Uniprot No.

Target Background

Function
ELOVL6 catalyzes the rate-limiting step in the long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme adds two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. It exhibits higher activity toward C16:0 acyl-CoAs, elongating fatty acids with 12, 14, and 16 carbons. ELOVL6 also participates in unsaturated C16 long-chain fatty acid synthesis and, to a lesser extent, C18:0 and other low-desaturation fatty acids. This enzyme contributes to the production of saturated and monounsaturated VLCFAs of varying chain lengths, which serve as precursors for membrane lipids and lipid mediators.
Gene References Into Functions
  1. Functional screening identified ELOVL6 as a key elongase in lung cancer squamous cell carcinoma cells. PMID: 26862848
  2. A combined ultra-high-throughput fluorescence screening and RapidFire mass spectrometry assay proved effective for ELOVL6 inhibitor discovery. PMID: 27793673
  3. An interaction between HLA-Cw6 and LCE genotypes influenced treatment response in psoriatic patients receiving anti-TNF therapy. PMID: 25794162
  4. KAR regulates ELOVL6 through two mechanisms: inducing conformational changes and facilitating product release from the ELOVL6-KAR complex by converting 3-ketoacyl-CoA to 3-hydroxyacyl-CoA. PMID: 25003994
  5. Elevated ELOVL6 expression, responsible for C16 fatty acid elongation, was observed in liver samples from patients with non-alcoholic steatohepatitis (NASH) or NASH-related hepatocellular carcinoma. PMID: 24714086
  6. The ELOVL6 gene polymorphism rs12504538 was associated with increased risk of type 2 diabetes mellitus (T2DM) due to elevated insulin resistance. PMID: 23903678
  7. Reduced Elovl6 expression was observed in human lung tissue with idiopathic pulmonary fibrosis. PMID: 24113622
  8. Elovl6 expression correlated positively with NASH severity and liver injury. PMID: 22753171
  9. Cystic fibrosis cells showed increased metabolism of n-7 and n-9 fatty acids, alongside elevated expression of Delta5, Delta6, Delta9 desaturases, and elongases 5 and 6. PMID: 21544602
  10. Genetic variations in ELOVL6 were linked to insulin sensitivity. PMID: 21701577
  11. Inhibition of ELOVL6 is a potential therapeutic strategy for insulin resistance, diabetes, cardiovascular disease, and related metabolic disorders. PMID: 19259639
Database Links

HGNC: 15829

OMIM: 611546

KEGG: hsa:79071

STRING: 9606.ENSP00000304736

UniGene: Hs.412939

Protein Families
ELO family, ELOVL6 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is the primary enzymatic function of ELOVL6 in fatty acid metabolism?

ELOVL6 catalyzes the first and rate-limiting reaction in the long-chain fatty acids elongation cycle, which occurs in the endoplasmic reticulum. This enzyme specifically elongates fatty acids with 12, 14, and 16 carbons, with highest activity toward C16:0 acyl-CoAs. The reaction involves a condensation between an acyl-CoA and malonyl-CoA (serving as a two-carbon donor), resulting in the formation of 3-keto acyl-CoA .

The complete fatty acid elongation pathway consists of four sequential reactions:

  • Condensation (catalyzed by ELOVL6)

  • Reduction of 3-keto acyl-CoA by 3-keto acyl-CoA reductase

  • Dehydration by 3-hydroxy acyl-CoA dehydratase

  • Final reduction by trans-2,3-enoyl-CoA reductase

This cycle adds two carbon units per iteration, allowing for the progressive elongation of fatty acids .

How does ELOVL6 compare structurally and functionally to other members of the ELOVL family?

In humans, there are seven ELOVL enzymes (ELOVL1-7) that share 24-57% sequence identity but demonstrate distinct substrate preferences:

ELOVL IsoformPrimary SubstratesMain Tissues ExpressedKey Functions
ELOVL1Saturated and monounsaturated C22-C26WidespreadProduction of C26:0 VLCFAs
ELOVL2PUFA C20-C22Liver, testesDHA synthesis
ELOVL3Saturated and monounsaturated C16-C22Brown adipose tissueThermoregulation
ELOVL4VLC (≥C28) saturated and polyunsaturatedBrain, retina, skin, Meibomian glands, testesProduction of VLC-SFAs and VLC-PUFAs
ELOVL5PUFA C18-C20WidespreadProduction of arachidonic acid
ELOVL6Saturated and monounsaturated C12-C16Liver, brain, heartConversion of C16:0 to C18:0
ELOVL7C16-C20 (preference for C18:3)Multiple tissuesVarious lipid metabolic functions

Unlike ELOVL4, which is involved in producing very long chain fatty acids (≥C28), ELOVL6 primarily mediates the elongation of palmitate (C16:0) to stearate (C18:0) and palmitoleate (C16:1n-7) to vaccenate (C18:1n-7) .

What are the optimal expression systems for producing functional recombinant human ELOVL6?

Based on research approaches documented in the literature, several expression systems have been utilized for ELOVL6:

Mammalian Expression Systems:

  • HEK293 or CHO cells provide proper post-translational modifications and membrane insertion capability

  • Expression vectors containing CMV promoters yield reliable expression

  • Optimal transfection efficiency achieved using lipid-based reagents for this transmembrane protein

Protocol Overview:

  • Clone human ELOVL6 cDNA into a mammalian expression vector (e.g., pcDNA3.1) with appropriate tags (His, FLAG, or GFP)

  • Transfect into mammalian cells using lipofection or electroporation

  • Select stable cell lines using appropriate antibiotics

  • Verify expression through Western blotting using anti-ELOVL6 antibodies

  • Confirm functionality through enzyme activity assays measuring the conversion of C16:0 to C18:0

When working with recombinant ELOVL6, maintaining the integrity of the membrane-spanning domains is essential for preserving enzymatic activity, as ELOVL6 is an integral membrane protein of the endoplasmic reticulum .

How can researchers effectively measure ELOVL6 enzymatic activity in experimental settings?

Methodological Approach to Assessing ELOVL6 Activity:

  • Substrate-to-Product Ratio Analysis:

    • Extract cellular lipids using Bligh and Dyer method or similar techniques

    • Perform gas chromatography–mass spectrometry (GC-MS) analysis

    • Calculate the ratio of C18:0/C16:0 or C18:1/C16:1 as indicators of ELOVL6 activity

    • A decreased ratio indicates reduced ELOVL6 activity

  • Direct Activity Assay Using Radiolabeled Substrates:

    • Prepare microsomes from cells expressing ELOVL6

    • Incubate with [14C]palmitoyl-CoA and malonyl-CoA

    • Extract lipids and separate by thin-layer chromatography

    • Quantify elongated products using a phosphorimager

  • Lipidomic Analysis:

    • Mass spectrometry-based analysis of phospholipid species

    • Focus on phosphatidylethanolamine and phosphatidylcholine

    • Analyze chain length distribution patterns

    • An accumulation of shorter fatty acids composing phospholipids indicates ELOVL6 inhibition

Example data from a study where ELOVL6 was genetically or chemically inhibited showed significant alterations in phosphatidylethanolamine composition, with an accumulation of shorter fatty acids and a decrease in longer fatty acids .

What approaches can be used to inhibit ELOVL6 function in experimental models?

Three primary approaches have been documented in the literature:

1. Genetic Inhibition:

  • siRNA-mediated knockdown:

    • Transfection of siRNAs targeting ELOVL6 mRNA

    • Typically achieves 70-90% reduction in expression

    • Example: siRNA-mediated knockdown in human aortic smooth muscle cells (HASMC) reduced ELOVL6 expression by approximately 80%

  • CRISPR/Cas9 gene editing:

    • Complete knockout of ELOVL6 gene

    • Allows for stable cell lines and animal models

    • Example: ELOVL6 knockout in T3M4 pancreatic cancer cells showed reduced proliferation and colony formation

  • shRNA expression:

    • Lentiviral delivery of shRNAs targeting ELOVL6

    • Provides longer-term suppression compared to siRNA

    • Example: Two distinct shRNAs (shELOVL6 #1 and shELOVL6 #2) in T3M4 and Patu 8988T cell lines showed consistent reduction in ELOVL6 expression

2. Chemical Inhibition:

  • Small molecule inhibitors:

    • ELOVL6-IN-2 is a documented chemical inhibitor

    • Provides rapid and reversible inhibition

    • Examples show comparable effects to genetic inhibition on cell proliferation and fatty acid composition

3. Mouse Models:

  • Elovl6-/- (global knockout) mice:

    • Show altered fatty acid composition with increased palmitate (C16:0) and decreased oleate (C18:1 n-9) levels

    • Protected against diet-induced insulin resistance

    • Exhibit reduced expression of stearoyl-CoA desaturase (SCD1)

Each approach offers distinct advantages depending on research objectives, with genetic methods providing specificity while chemical inhibition offers temporal control .

How does ELOVL6 function impact metabolic disorders, particularly insulin resistance and type 2 diabetes?

ELOVL6 has emerged as a critical metabolic checkpoint in obesity-related insulin resistance and type 2 diabetes mellitus (T2DM), with several lines of evidence supporting its role:

Mechanistic Findings:

These findings suggest that modulating the cellular fatty acid composition by limiting Elovl6 expression or activity could represent a novel therapeutic approach for treating T2DM and metabolic syndrome .

What role does ELOVL6 play in cardiovascular pathophysiology, particularly related to vascular smooth muscle cells (VSMCs)?

ELOVL6 has been identified as a key regulator of vascular smooth muscle cell (VSMC) phenotype and function, with implications for cardiovascular disease:

1. VSMC Phenotypic Switching:

  • ELOVL6 knockdown in human aortic smooth muscle cells (HASMC) reduces proliferation, migration, and expression of VSMC markers (SMα-actin and SM22α)

  • This suggests ELOVL6 regulates VSMC phenotypic switching between contractile and synthetic states

2. Molecular Mechanisms:

The effects of ELOVL6 on VSMCs operate through several interconnected pathways:

  • AMPK/KLF4 Signaling:

    • ELOVL6 knockdown increases phosphorylation of AMPK and expression of KLF4

    • This leads to growth arrest and downregulation of VSMC marker expression

    • The effect is reversed by AMPK inhibition with compound C

  • ROS Production:

    • ELOVL6 deficiency increases reactive oxygen species (ROS) production in VSMCs

    • This ROS increase appears to be upstream of AMPK activation

    • Antioxidant treatment with NAC attenuates AMPK phosphorylation in ELOVL6-knockdown cells

  • Fatty Acid Metabolism:

    • ELOVL6 knockdown increases ACC phosphorylation, which indicates increased fatty acid oxidation

    • This metabolic shift away from fatty acid synthesis toward oxidation contributes to the altered VSMC phenotype

3. In Vivo Evidence:

  • In mouse models, Elovl6 deficiency leads to altered aortic fatty acid composition

  • Specifically, there is an increase in palmitate (C16:0) and a decrease in oleate (C18:1 n-9)

  • Expression of stearoyl-CoA desaturase 1 (SCD1) is reduced in the aorta of Elovl6-/- mice

These findings suggest that ELOVL6-driven fatty acid metabolism is a critical regulator of VSMC function and may represent a potential therapeutic target for vascular diseases like atherosclerosis and post-angioplasty restenosis .

What is the emerging role of ELOVL6 in cancer biology, particularly in pancreatic ductal adenocarcinoma (PDAC)?

Recent research has revealed ELOVL6 as a critical player in cancer metabolism, particularly in pancreatic ductal adenocarcinoma (PDAC):

1. Regulation by Oncogenic Signaling:

  • ELOVL6 is directly regulated by the c-MYC oncogene in PDAC

  • Chromatin immunoprecipitation and RT-qPCR (ChIP-qPCR) confirmed direct binding of c-MYC to the ELOVL6 promoter

  • c-MYC upregulates ELOVL6 during transformation and tumor progression in various PDAC mouse models and cell lines

2. Impact on Cancer Cell Properties:

ELOVL6 inhibition affects multiple cancer cell attributes:

  • Reduced Proliferation:

    • Both genetic (shRNAs, CRISPR knockout) and chemical (ELOVL6-IN-2) inhibition of ELOVL6 decreased proliferation in PDAC cell lines

    • Cell cycle analysis revealed accumulation of cells in G1 phase without increasing apoptosis

    • RNA-seq analysis showed downregulation of "myc targets" and "cell cycle" pathways

  • Decreased Migration:

    • ELOVL6 downregulation impaired cell migration as demonstrated by delayed wound closure and reduced migration in transwell assays

  • Altered Membrane Properties:

    • ELOVL6 inhibition led to significant changes in membrane composition, thickness, rigidity, and permeability

    • Transmission electron microscopy revealed decreased membrane thickness

    • Mechanical testing showed reduced membrane rigidity and increased flexibility

3. Therapeutic Implications:

ELOVL6 inhibition shows promising therapeutic potential:

These findings position ELOVL6 as a promising therapeutic target in PDAC, potentially improving treatment outcomes for this highly lethal cancer that currently has a survival rate of only 12% .

How do alterations in ELOVL6 activity affect membrane properties and cellular signaling pathways?

ELOVL6 modulation has profound effects on membrane architecture and function, which consequently impacts multiple cellular signaling pathways:

1. Membrane Structural Changes:

When ELOVL6 is inhibited or knocked down, several key membrane parameters are altered:

  • Fatty Acid Composition:

    • Increased C16:0 (palmitate) and decreased C18:0 (stearate) and C18:1 n-9 (oleate)

    • Lipidomic analysis of phosphatidylethanolamine and phosphatidylcholine shows accumulation of shorter fatty acids and reduction in longer fatty acids

  • Physical Properties:

    • Reduced membrane thickness (quantified by transmission electron microscopy)

    • Decreased membrane rigidity (measured by indentation techniques)

    • Increased membrane flexibility and variability in cell shape

2. Impact on Cellular Transport:

These membrane alterations affect various cellular transport mechanisms:

  • Enhanced Pinocytosis:

    • Both micropinocytosis (measured by uptake of Alexa 488-dextran)

    • Increased macropinocytosis (assessed by Lucifer Yellow uptake)

    • Higher membrane permeability (demonstrated by calcein entrance)

3. Signaling Pathway Modulation:

ELOVL6 inhibition impacts several important signaling cascades:

  • AMPK/mTOR Axis:

    • Increased AMPK phosphorylation (at Thr-172)

    • Reduced phosphorylation of downstream mTOR targets (p70S6K and 4EBP1)

    • This leads to suppression of protein synthesis and cell growth

  • ROS-Mediated Signaling:

    • Enhanced ROS production

    • This activates stress-response pathways

    • Treatment with antioxidants like N-acetylcysteine (NAC) attenuates these effects

  • Transcriptional Regulation:

    • Upregulation of KLF4 (Krüppel-like factor 4), a transcription factor that regulates cell differentiation

    • Downregulation of VSMC contractile markers like SMα-actin and SM22α

    • RNA-seq analysis of ELOVL6-inhibited cells shows differential expression of genes involved in cell cycle, metabolism, and signaling pathways

4. Metabolic Rewiring:

ELOVL6 modulation shifts cellular metabolism:

  • Fatty Acid Oxidation:

    • Increased ACC phosphorylation (indicating ACC inactivation)

    • Enhanced fatty acid oxidation rate (measured using [14C]palmitic acid)

    • Upregulation of PPARα and other genes involved in fatty acid oxidation

These multifaceted effects on membrane properties and signaling networks demonstrate how ELOVL6-mediated fatty acid composition serves as a critical regulatory node that integrates cell structure with function and metabolism .

What approaches can be used to analyze the tissue-specific effects of ELOVL6 in complex disease models?

Investigating tissue-specific roles of ELOVL6 requires sophisticated methodological approaches combining genetic manipulation, biochemical analysis, and advanced imaging techniques:

1. Tissue-Specific Genetic Modification:

  • Conditional Knockout Models:

    • Cre-loxP system targeting ELOVL6 in specific tissues

    • Example applications: liver-specific (Albumin-Cre), vascular-specific (SM22α-Cre), or pancreatic β-cell-specific (Ins-Cre) ELOVL6 deletion

    • These models allow dissection of tissue-autonomous effects from systemic consequences

  • Inducible Systems:

    • Tamoxifen-inducible CreERT2 for temporal control of ELOVL6 deletion

    • Enables study of acute versus chronic effects and avoids developmental compensation

    • Can distinguish between developmental and adult roles of ELOVL6

2. Tissue-Specific Analytical Techniques:

  • Laser Capture Microdissection:

    • Isolation of specific cell types from tissue sections

    • Analysis of ELOVL6 expression and fatty acid composition in precise cellular populations

    • Combined with RNA-seq or lipidomics for comprehensive molecular profiling

  • Spatial Transcriptomics/Lipidomics:

    • Preserves spatial information while analyzing gene expression or lipid profiles

    • Reveals regional heterogeneity in ELOVL6 function within tissues

    • Technologies like Visium (10x Genomics) or MALDI-imaging mass spectrometry provide spatial resolution

3. Multi-Omics Integration:

Comprehensive multi-level analysis provides deeper insights:

  • Integrated Analysis Pipeline:

    • Tissue-specific transcriptomics (RNA-seq)

    • Proteomics (mass spectrometry)

    • Lipidomics (LC-MS/MS or GC-MS)

    • Metabolomics (NMR or MS-based)

    • Integration using computational tools

  • Example Application:

    • In a study of ELOVL6 in pancreatic cancer, researchers combined:

      • RNA-seq to identify differentially expressed genes

      • Lipidomic analysis to characterize changes in membrane lipid composition

      • Functional assays to assess biological consequences

      • This multi-omics approach revealed mechanisms linking fatty acid elongation to membrane properties and drug uptake

4. Advanced In Vivo Imaging:

  • Intravital Microscopy:

    • Real-time visualization of cellular processes in living animals

    • Can be combined with fluorescent fatty acid analogs to track metabolism in vivo

    • Particularly useful for studying dynamic processes like vascular remodeling or tumor growth

  • PET Imaging with Radiolabeled Fatty Acids:

    • Non-invasive tracking of fatty acid metabolism in different tissues

    • Can assess ELOVL6 activity in living subjects

    • Enables longitudinal studies of ELOVL6 function

These methodological approaches provide researchers with the tools to unravel the complex tissue-specific roles of ELOVL6 in various disease contexts, moving beyond correlative observations to establish causative mechanisms.

What are common challenges in interpreting fatty acid composition data in ELOVL6 research, and how can they be addressed?

Researchers frequently encounter several challenges when analyzing fatty acid profiles in ELOVL6 studies. Here are key issues and methodological solutions:

1. Distinguishing Direct vs. Indirect Effects of ELOVL6 Modulation:

  • Challenge: Changes in ELOVL6 activity affect multiple fatty acids beyond its direct substrates and products.

  • Solution:

    • Perform time-course experiments to identify primary versus secondary changes

    • Use isotope-labeled fatty acid precursors (e.g., [13C]palmitate) to track specific metabolic fates

    • Compare results with specific inhibitors of other enzymes in the pathway (e.g., SCD inhibitors) to deconvolute effects

2. Compensatory Mechanisms Confounding Results:

  • Challenge: Long-term ELOVL6 inhibition often triggers compensatory changes in other elongases or desaturases.

  • Solution:

    • Analyze expression of related enzymes (other ELOVLs, SCDs) alongside fatty acid profiles

    • Use acute inhibition models (inducible systems or rapid-acting inhibitors) to minimize compensation

    • Create comprehensive lipid network models that account for regulatory feedback

3. Tissue Heterogeneity and Sample Preparation Issues:

  • Challenge: Different cell types within a tissue may have distinct fatty acid profiles, and sample preparation can introduce artifacts.

  • Solution:

    • Use cell sorting or laser capture microdissection before lipid analysis

    • Employ rapid tissue freezing techniques to prevent lipid degradation

    • Include multiple internal standards representing different lipid classes

    • Validate findings using multiple extraction methods

4. Analytical Method Limitations:

  • Challenge: Different analytical platforms (GC-MS, LC-MS/MS) have varying sensitivities for detecting specific fatty acids.

  • Solution:

    • Employ multiple complementary analytical techniques

    • Use both targeted and untargeted lipidomic approaches

    • Develop standardized analytical protocols with appropriate quality controls

    • Consider both relative (percentage) and absolute quantification methods

5. Data Interpretation Framework:

When interpreting fatty acid composition data in ELOVL6 research, consider this hierarchical approach:

  • Primary Elongation Products:

    • Focus first on the C16:0/C18:0 and C16:1/C18:1 ratios as direct indicators of ELOVL6 activity

    • Increased ratios suggest reduced ELOVL6 function

  • Lipid Class Distribution:

    • Analyze how changes in fatty acid composition affect various lipid classes (phospholipids, triglycerides, etc.)

    • Different lipid pools may show distinct responses to ELOVL6 modulation

  • Membrane Parameter Correlations:

    • Correlate fatty acid changes with measured membrane properties (fluidity, thickness)

    • This helps establish functional consequences of the observed biochemical changes

  • Pathway Integration:

    • Place fatty acid changes in the context of related metabolic pathways

    • Consider interactions with glucose metabolism, inflammation, and oxidative stress

How can researchers address experimental variability when assessing ELOVL6 function in different cellular systems?

Experimental variability is a significant challenge in ELOVL6 research due to the complexity of lipid metabolism and differences across cellular systems. Here are strategic approaches to minimize and account for this variability:

1. Cell Culture Standardization:

  • Challenge: Variations in culture conditions significantly impact lipid metabolism.

  • Methodological Solutions:

    • Serum Considerations:

      • Use defined serum replacements instead of FBS to eliminate batch-to-batch variability

      • If using FBS, test multiple lots and utilize the same lot throughout a study

      • Document serum starvation periods precisely (typically 6-12 hours before experiments)

    • Media Formulation:

      • Standardize glucose and glutamine concentrations

      • Control fatty acid availability by using charcoal-stripped serum or defined fatty acid supplements

      • Document passage number and confluence level at experiment time

    • Environmental Factors:

      • Maintain consistent oxygen levels (hypoxia affects lipid metabolism)

      • Control for circadian variations in metabolism by conducting experiments at consistent times

      • Ensure consistent temperature and CO₂ levels across experiments

2. Genetic Manipulation Controls:

  • Challenge: Variable knockdown/knockout efficiency and off-target effects.

  • Methodological Solutions:

    • For siRNA/shRNA:

      • Use multiple siRNA/shRNA sequences targeting different regions of ELOVL6

      • Validate knockdown at both mRNA (qPCR) and protein (Western blot) levels

      • Include non-targeting controls with similar chemical properties

    • For CRISPR/Cas9:

      • Sequence-verify edited regions in cell populations

      • Use multiple guide RNAs and clone selection

      • Include isogenic control lines subjected to the same procedures but without ELOVL6 targeting

    • Rescue Experiments:

      • Perform functional rescue with wild-type ELOVL6 to confirm specificity

      • Use expression constructs resistant to siRNA/shRNA when applicable

3. Analytical Standardization:

  • Challenge: Variability in lipid extraction and analysis methods.

  • Methodological Solutions:

    • Sample Processing:

      • Process all samples simultaneously when possible

      • Include pooled quality control samples

      • Use automated extraction protocols to minimize operator variability

    • Instrumental Analysis:

      • Employ internal standards for each major lipid class

      • Randomize sample order during analysis

      • Include calibration curves spanning the expected concentration range

      • Run quality control samples periodically throughout analytical batches

4. Statistical Approaches:

  • Challenge: Distinguishing biological from technical variability.

  • Methodological Solutions:

    • Experimental Design:

      • Calculate appropriate sample sizes based on preliminary data

      • Include biological replicates (different passages or animals) and technical replicates

      • Use randomization and blinding where applicable

    • Data Analysis:

      • Apply normalization methods appropriate for lipidomic data

      • Use statistical methods that account for multiple testing

      • Consider employing mixed-effects models to account for batch effects

      • Report effect sizes alongside p-values

5. System-Specific Considerations:

Different experimental systems require tailored approaches:

SystemSpecial ConsiderationsRecommended Controls
Primary cellsLimited passages, donor variabilityMatched controls from same donor, multiple donors
Cell linesMetabolic adaptations, genetic driftAuthentication, consistent passage number
Animal modelsStrain background, housing conditionsLittermate controls, consistent diet
Patient samplesMedication effects, comorbiditiesCareful phenotyping, matched controls

These methodological considerations help ensure that observed changes in ELOVL6 function reflect true biological effects rather than experimental artifacts .

What are the key considerations when designing inhibition studies targeting ELOVL6 for potential therapeutic applications?

When designing inhibition studies targeting ELOVL6 for therapeutic development, researchers should consider several critical factors that influence experimental validity and translational potential:

1. Target Specificity and Selectivity Assessment:

  • Challenge: ELOVL family members share structural similarities, making selective inhibition difficult.

  • Methodological Approach:

    • Selectivity Profiling:

      • Test inhibitor effects on all seven ELOVL family members

      • Perform enzyme activity assays with recombinant proteins of each ELOVL

      • Assess IC₅₀ values across the family to quantify selectivity

    • Off-Target Screening:

      • Conduct broad screening against related lipid-metabolizing enzymes

      • Perform transcriptomic and proteomic analyses to identify unintended effects

      • Use ELOVL6 knockout cells as controls to identify inhibitor effects beyond ELOVL6 inhibition

    • Structure-Activity Relationship (SAR) Studies:

      • Develop and test structural analogs to improve selectivity

      • Use computational modeling of inhibitor binding to guide design

2. Pharmacokinetic and Pharmacodynamic Considerations:

  • Challenge: Achieving sufficient target engagement in relevant tissues.

  • Methodological Approach:

    • PK Assessment:

      • Determine inhibitor stability in plasma and microsomes

      • Assess tissue distribution, particularly in target tissues

      • Measure half-life and clearance rates

    • PD Biomarkers:

      • Develop reliable biomarkers of ELOVL6 inhibition (e.g., C16:0/C18:0 ratio in plasma)

      • Establish dose-response relationships between inhibitor concentration and biomarker changes

      • Determine minimal effective dose for target engagement

    • Timing Considerations:

      • Assess acute versus chronic inhibition effects

      • Determine optimal dosing schedule based on disease model

3. Context-Dependent Effects:

  • Challenge: ELOVL6 inhibition may have different effects depending on disease context.

  • Methodological Approach:

    • Diverse Disease Models:

      • Test inhibitors across multiple disease models (metabolic, cardiovascular, cancer)

      • Include genetic models that recapitulate human disease mutations

      • Compare effects in prevention versus treatment paradigms

    • Combination Studies:

      • Assess ELOVL6 inhibitors alone and in combination with standard therapies

      • Example: Combined treatment with ELOVL6-IN-2 and Abraxane showed synergistic effects in pancreatic cancer models

      • Identify potential synergistic or antagonistic interactions

    • Resistance Mechanisms:

      • Investigate potential compensatory pathways that may develop with chronic inhibition

      • Establish models of acquired resistance

4. Therapeutic Window Assessment:

  • Challenge: Balancing efficacy against potential adverse effects.

  • Methodological Approach:

    • Safety Assessment:

      • Evaluate effects on essential tissues where ELOVL6 functions (liver, heart, brain)

      • Monitor for potential lipotoxicity from altered fatty acid profiles

      • Assess impact on membrane integrity in different cell types

    • Dose Optimization:

      • Establish dose-response relationships for both efficacy and toxicity endpoints

      • Determine therapeutic index (ratio of toxic dose to effective dose)

      • Explore intermittent dosing strategies if continuous inhibition causes adverse effects

    • Genetic Validation:

      • Compare pharmacological inhibition with genetic models (tissue-specific knockouts)

      • Use heterozygous models to mimic partial inhibition

5. Translational Considerations:

  • Challenge: Bridging preclinical findings to potential clinical applications.

  • Methodological Approach:

    • Human Relevance:

      • Verify ELOVL6 expression and relevance in human disease tissues

      • Use patient-derived xenografts or organoids for validation

      • Assess inhibitor effects in humanized models

    • Biomarker Development:

      • Identify non-invasive biomarkers suitable for clinical monitoring

      • Validate correlation between biomarker changes and disease outcomes

      • Develop companion diagnostics to identify potential responders

    • Specific Disease Applications:

      • For metabolic disease: focus on insulin sensitivity and hepatic steatosis endpoints

      • For cancer applications: evaluate effects on tumor growth, drug uptake, and survival

      • For cardiovascular applications: assess impact on vascular remodeling and atherosclerosis

By systematically addressing these considerations, researchers can design robust inhibition studies that maximize the translational potential of ELOVL6 as a therapeutic target while minimizing risks and potential limitations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.