Recombinant Human Elongation of very long chain fatty acids protein 7 (ELOVL7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ELOVL7; Elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase ELOVL7; ELOVL fatty acid elongase 7; ELOVL FA elongase 7; Very long chain 3-ketoacyl-CoA synthase 7; Very long chain 3-oxoacyl-CoA synthase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
ELOVL7
Target Protein Sequence
MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRK PFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLY YFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAV HVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFAC IIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN
Uniprot No.

Target Background

Function
ELOVL7 catalyzes the initial and rate-limiting step within the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzymatic process allows for the addition of two carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. This enzyme exhibits higher activity toward C18 acyl-CoAs, particularly C18:3(n-3) acyl-CoAs and C18:3(n-6)-CoAs. It also demonstrates activity toward C20:4-, C18:0-, C18:1-, C18:2- and C16:0-CoAs, and exhibits weak activity toward C20:0-CoA. ELOVL7 shows minimal or no activity toward C22:0-, C24:0-, or C26:0-CoAs. It may participate in the production of saturated and polyunsaturated VLCFAs of varying chain lengths, which are involved in diverse biological processes as precursors of membrane lipids and lipid mediators.
Gene References Into Functions
  1. Data indicates that ELOVL7, SOCS3, ACSL4, and CLU were upregulated, while PRKAR1A and ABCG1 were downregulated in the phlegm-dampness group. PMID: 27928700
  2. ELOVL7 knockdown or mTOR inhibition impairs HCMV-induced fatty acid elongation. PMID: 25732827
  3. Progression of the VLCFA cycle enhances ELOVL7 activity. PMID: 21959040
  4. Overexpression of ELOVL7 is associated with prostate cancer growth through saturated long-chain fatty acid metabolism. PMID: 19826053
Database Links

HGNC: 26292

OMIM: 614451

KEGG: hsa:79993

STRING: 9606.ENSP00000402634

UniGene: Hs.274256

Protein Families
ELO family, ELOVL7 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in most tissues except heart and skeletal muscle.

Q&A

What is the structural architecture of human ELOVL7?

Human ELOVL7 possesses a distinctive structural organization consisting of seven transmembrane (TM) helices (TM1-TM7). Six of these helices (TM2-7) form an inverted barrel arrangement surrounding a narrow tunnel approximately 35 Å in length . This central tunnel serves as the catalytic channel for fatty acid substrates. The structure is formed by two units of three helices (TM2-4 and TM5-7), each arranged in an antiparallel fashion, which are assembled as an inverted repeat around the central tunnel . TM1 lies outside this barrel structure, positioned against TM3/4.

This structural arrangement represents a novel protein fold that is distinct from the typical GPCR 7TM fold, as confirmed by DALI structural comparison searches . The protein crystallizes as a head-to-tail dimer with a small, unconserved interaction surface of approximately 870 Ų, which is consistent with size-exclusion chromatography and multi-angle light scattering (SEC-MALS) analyses performed in solution .

How does ELOVL7 catalyze fatty acid elongation?

ELOVL7 catalyzes fatty acid elongation through a ping-pong type mechanism that involves the formation of an unusual acyl-imidazole intermediate . The reaction begins with the first acyl-CoA substrate entering the 35 Å tunnel where the elongation reaction takes place. The crystal structure of human ELOVL7 revealed the presence of a co-purified, covalently bound product analogue within this tunnel, providing insights into the substrate binding mode .

The enzyme shows preferential involvement in elongating saturated very-long-chain fatty acids (SVLFA, C20:0 and longer), as determined by in vitro fatty acid elongation assays and fatty acid composition analyses . This specificity distinguishes ELOVL7 from other members of the ELOVL family that may have different substrate preferences. During catalysis, ELOVL7 adds two-carbon units to the growing fatty acid chain, contributing to the diverse pool of long-chain fatty acids required for various cellular functions.

How is ELOVL7 expression regulated in cellular systems?

ELOVL7 expression is regulated through multiple mechanisms, with the androgen pathway playing a significant role. Research has demonstrated that ELOVL7 expression is controlled through SREBP1 (Sterol Regulatory Element-Binding Protein 1), similar to other lipogenic enzymes . This regulation links ELOVL7 activity to cellular lipid homeostasis and steroid hormone signaling pathways.

In mammary epithelial cells, ELOVL7 shows dynamic expression patterns that vary according to lactation stages. Studies in goat mammary epithelial cells revealed that ELOVL7 had the highest expression during the dry period compared to peak and late lactation periods . This temporal regulation suggests a specialized role in modulating lipid composition during different physiological states.

The interaction between ELOVL7 and other lipid metabolism genes creates a complex regulatory network. Overexpression of ELOVL7 was correlated with lower expression of diacylglycerol O-acyltransferase 2 (DGAT2) and stearoyl-CoA desaturase 1 (SCD1), while knockdown affected the expression of fatty acid binding protein 3 (FABP3) and fatty acid desaturase 2 (FADS2) . These interactions highlight ELOVL7's integrated role within the broader lipid metabolism machinery.

What expression systems are effective for recombinant ELOVL7 production?

The baculovirus expression system in Spodoptera frugiperda (Sf9) insect cells has proven effective for recombinant ELOVL7 production. Detailed methodology involves subcloning the human ELOVL7 gene (encoding residues Met1 to Asn281) into the pFB-CT10HF-LIC vector, followed by baculovirus generation using the Bac-to-Bac system . This process requires transforming the construct into Escherichia coli DH10Bac strain to generate bacmid DNA, which is then used to transfect Sf9 cells for baculovirus production.

For large-scale expression, Sf9 cells are infected with the recombinant baculovirus and incubated for 72 hours at 27°C in shaker flasks. Cells are harvested by centrifugation at 900 g for 10 minutes, followed by resuspension in PBS and a second centrifugation step at 900 g for 20 minutes . This insect cell expression system appears particularly suitable for ELOVL7 due to its ability to properly fold and insert this multi-pass transmembrane protein into membranes.

Mammalian cell expression systems have also been employed for functional studies, particularly when investigating ELOVL7's biological roles rather than structural characterization. Cell lines such as LNCaP and 22Rv1 have been successfully transfected with ELOVL7 expression constructs using reagents like FuGene6 , making them suitable models for studying ELOVL7 function in a more physiologically relevant context.

What purification strategies yield high-quality ELOVL7 protein for structural studies?

Successful purification of ELOVL7 for structural studies has been achieved through a multi-step process designed to maintain protein integrity while removing contaminants. Although the complete purification protocol isn't fully detailed in the search results, key aspects can be inferred from the structural determination methods.

The purification likely involves cell lysis followed by membrane fraction isolation, solubilization using detergents such as OGNG (octyl glucose neopentyl glycol, observed in the crystal structure), and affinity chromatography utilizing the engineered tags in the expression construct . The final structural model contained not only the protein (residues 16-269 in one chain and 14-269 in the other) but also a covalently bound 3-keto-CoA acyl lipid, four OGNG detergent molecules, and 112 solvent molecules, indicating successful maintenance of the native-like environment during purification .

Mass spectrometry played a crucial role in quality assessment, with denaturing intact mass spectrometry measurements performed using an Agilent 1290 Infinity LC system . This technique allows verification of protein purity, integrity, and the presence of post-translational modifications or bound ligands.

How can researchers effectively analyze ELOVL7 activity in experimental systems?

Several complementary approaches have been developed to assess ELOVL7 activity:

Fatty acid elongation assays provide direct measurement of ELOVL7's enzymatic function. In vitro assays using purified protein or cellular systems expressing ELOVL7 can determine specific substrate preferences and kinetic parameters . These assays typically monitor the conversion of fatty acyl-CoA substrates to elongated products.

Fatty acid composition analysis using techniques such as gas chromatography or liquid chromatography coupled with mass spectrometry allows researchers to quantify changes in cellular fatty acid profiles resulting from ELOVL7 activity. This approach has revealed that ELOVL7 significantly affects the levels of specific fatty acids, including palmitoleic acid (C16:1n7), oleic acid (C18:1n9), vaccenic acid (C18:1n7), and linoleic acid (C18:2) .

The elongation index, calculated as the ratio of elongated products to substrates (e.g., C18:1/C16:1), provides a quantitative measure of ELOVL7 activity. Studies have shown that ELOVL7 overexpression significantly upregulates the elongation index of C16:1 in goat mammary epithelial cells while having minimal effects on the C16:0 elongation index .

Gene expression analysis through qRT-PCR can indirectly assess ELOVL7 function by monitoring changes in related lipid metabolism genes. Changes in DGAT2, SCD1, FABP3, and FADS2 expression have been observed in response to ELOVL7 modulation, providing insights into the enzyme's broader metabolic impact .

What evidence links ELOVL7 to prostate cancer development?

ELOVL7 has been identified as overexpressed in prostate cancer cells through genome-wide gene expression analysis . This overexpression suggests a potential role in prostate carcinogenesis and progression. Several lines of evidence strengthen this association:

Knockdown studies using shRNA against ELOVL7 resulted in dramatic attenuation of prostate cancer cell growth, demonstrating its functional importance in maintaining cancer cell viability . The target sequences effective for ELOVL7 knockdown include 5′-CAAGCAACAACAACAACAA-3′ and 5′-GCCTTCAGTGATCTTACAT-3′, providing valuable tools for investigating ELOVL7's role in cancer biology.

Diet-cancer interactions have been observed, with high-fat diets promoting the growth of in vivo tumors expressing ELOVL7 . This finding aligns with epidemiological studies showing associations between dietary fat intake and prostate cancer development, suggesting ELOVL7 may be a molecular link between lipid metabolism and cancer progression.

Mechanistically, ELOVL7 appears involved in synthesis of saturated very-long-chain fatty acids (SVLFAs) that affect phospholipid and neutral lipid compositions in cancer cells. Particularly notable is its effect on cholesterol ester, which serves as a source for de novo steroid synthesis . Given that prostate cancer growth is often androgen-dependent, ELOVL7's influence on de novo androgen synthesis provides a plausible mechanism for its pro-tumorigenic effects.

How does ELOVL7 modulate fatty acid composition in mammary epithelial cells?

ELOVL7 plays a significant role in altering the long-chain unsaturated fatty acid profile in mammary epithelial cells. Studies in goat mammary epithelial cells (GMEC) have provided detailed insights into these effects:

Overexpression of ELOVL7 significantly decreased the concentration of palmitoleic acid (C16:1n7) and oleic acid (C18:1n9), while increasing the levels of vaccenic acid (C18:1n7) and linoleic acid (C18:2) . These changes demonstrate ELOVL7's ability to reshape the cellular fatty acid landscape, particularly affecting monounsaturated and polyunsaturated long-chain fatty acids.

The elongation index of C16:1 was significantly upregulated in GMECs overexpressing ELOVL7, while the elongation index of C16:0 (palmitate) showed minimal changes . This differential effect suggests substrate specificity in ELOVL7's elongation activity, with a preference for unsaturated over saturated C16 fatty acids in these cells.

ELOVL7 modulation affected the expression of genes involved in fatty acid transport and desaturation. Knockdown of ELOVL7 downregulated FABP3 and FADS2 mRNA levels, while overexpression correlated with reduced expression of SCD1 and DGAT2 . These changes in gene expression represent downstream effects that amplify ELOVL7's impact on cellular lipid metabolism.

Despite these significant changes in fatty acid profiles and related gene expression, ELOVL7 overexpression or knockdown did not affect triacylglycerol concentration in GMECs . This observation suggests ELOVL7's primary role may be in modulating membrane lipid composition rather than storage lipid accumulation in these cells.

What structural features determine ELOVL7 substrate specificity?

The unique structural architecture of ELOVL7 provides the foundation for its substrate specificity. The 35 Å long tunnel formed by the transmembrane barrel structure creates a defined space that accommodates fatty acid substrates of specific lengths and configurations . This tunnel's dimensions and chemical properties likely contribute to ELOVL7's preference for elongating saturated very-long-chain fatty acids (SVLFAs, C20:0 and longer) .

Key residues lining this tunnel likely play critical roles in substrate recognition and catalysis. The presence of a covalently bound product analogue in the crystal structure provides valuable insights into the substrate binding mode . Detailed analysis of the interactions between this ligand and the protein residues would illuminate the molecular determinants of specificity.

The structure reveals that ELOVL7 exists as a dimer with a small, unconserved interaction surface . While this dimerization may not directly affect substrate binding within the tunnel of each monomer, it could influence broader aspects of enzyme function such as membrane positioning, interactions with other proteins, or regulatory mechanisms.

Future research combining structural data with site-directed mutagenesis and functional assays would be valuable for mapping the specific residues that determine ELOVL7's substrate preferences compared to other ELOVL family members. Such insights could enable rational design of inhibitors or activity modulators with therapeutic potential.

How can researchers effectively generate and validate antibodies against ELOVL7?

Generating specific antibodies against ELOVL7 presents challenges common to multi-pass transmembrane proteins but is achievable using established approaches. Successful antibody production has been reported using synthetic peptides corresponding to the NH₂-terminal (SDLTSRTVHLYDNWIKDA) and COOH-terminal (CHFWYRAYTKGQRLPKTVK) regions of human ELOVL7 . These terminus-targeting strategies avoid the hydrophobic transmembrane domains that are often problematic for antibody recognition.

The immunization protocol involves synthesizing these peptide antigens and using them to immunize rabbits. The resulting immune sera can be purified using affinity columns, specifically Affi-Gel 10 activated affinity media conjugated with the peptide antigens . This purification step is crucial for reducing background and increasing specificity.

Validation of ELOVL7 antibodies should include multiple approaches:

  • Western blotting against recombinant ELOVL7 and endogenous protein in tissues with known expression

  • Immunohistochemistry with appropriate positive and negative controls

  • Testing in cells with ELOVL7 knockdown or overexpression

  • Pre-absorption controls using the immunizing peptides

For immunohistochemical applications, published protocols have used a 1:100 dilution of purified anti-ELOVL7 antibody with a 16-minute incubation time on an automated system (Ventana). The detection employs a biotin-avidin system with diaminobenzidine substrate and hematoxylin counterstaining . Specificity can be confirmed using rabbit non-immune serum as a negative control.

What genetic tools are most effective for modulating ELOVL7 expression in experimental systems?

Several genetic approaches have proven effective for modulating ELOVL7 expression in research applications:

Short hairpin RNA (shRNA) technology has successfully knocked down ELOVL7 expression. Effective target sequences include 5′-CAAGCAACAACAACAACAA-3′ and 5′-GCCTTCAGTGATCTTACAT-3′ . These sequences can be cloned into appropriate vectors (such as psiU6BX) for expression in mammalian cells. Transfection can be achieved using reagents like FuGene6, with selection using 800 μg/mL geneticin to establish stable knockdown cell lines .

Overexpression systems utilizing mammalian expression vectors containing the full ELOVL7 coding sequence have been employed to study gain-of-function effects. These systems have revealed significant changes in fatty acid profiles, particularly affecting monounsaturated fatty acids like C16:1n7 and C18:1n9 .

For time-course studies of ELOVL7 regulation, androgen stimulation protocols have been developed. These involve incubating cells (e.g., LNCaP) in phenol red-free RPMI 1640 with 10% charcoal-stripped FBS for 2 days, followed by treatment with 10 nmol/L R1881 (a synthetic androgen) . This approach allows investigation of ELOVL7's androgen-dependent regulation over various time points.

When assessing the functional consequences of ELOVL7 modulation, it's important to analyze both direct effects (changes in fatty acid profiles) and indirect effects (alterations in expression of other lipid metabolism genes like DGAT2, SCD1, FABP3, and FADS2) . This comprehensive analysis provides deeper insights into ELOVL7's role within cellular lipid metabolism networks.

What techniques are optimal for analyzing ELOVL7-mediated changes in cellular lipid profiles?

Investigating ELOVL7's impact on cellular lipid metabolism requires comprehensive analytical approaches:

Fatty acid composition analysis through gas chromatography or liquid chromatography coupled with mass spectrometry provides detailed profiles of the fatty acid species affected by ELOVL7 activity. This approach has revealed ELOVL7's differential effects on various fatty acids, including decreased C16:1n7 and C18:1n9 with increased C18:1n7 and C18:2 levels upon overexpression .

Lipid class separation techniques enable analysis of how ELOVL7 affects different lipid types. Studies have shown that ELOVL7 knockdown impacts saturated very-long-chain fatty acids in both phospholipids and neutral lipids (particularly cholesterol esters) . This distribution analysis provides insights into the functional consequences of ELOVL7 activity on membrane structure versus storage or signaling lipids.

Elongation index calculations, determined as the ratio of product to substrate fatty acids (e.g., C18:1/C16:1), offer a quantitative measure of ELOVL7 elongation activity. This metric has demonstrated ELOVL7's preferential elongation of C16:1 compared to C16:0 in mammary epithelial cells .

Mass spectrometry techniques, particularly denaturing intact mass spectrometry using systems like the Agilent 1290 Infinity LC, can provide detailed molecular characterization of lipid species . This approach enables precise identification and quantification of fatty acids and their derivatives, advancing our understanding of ELOVL7's metabolic impact.

How do researchers determine the three-dimensional structure of membrane proteins like ELOVL7?

Determining the structure of membrane proteins like ELOVL7 presents unique challenges due to their hydrophobic nature and requirement for a lipid environment. The ELOVL7 structure was successfully determined using X-ray crystallography to 2.6 Å resolution , illustrating a viable approach for similar proteins.

The crystallization process likely involved careful detergent selection, with OGNG (octyl glucose neopentyl glycol) detergent molecules observed in the final structure . Detergent choice is critical for maintaining protein stability while allowing crystal contacts to form. The presence of four OGNG molecules in the crystal structure highlights their importance in successful crystallization.

Phase determination for ELOVL7 involved sophisticated crystallographic techniques. Initial phases were determined using a dataset with anomalous signal, possibly from heavy atom derivatives or selenomethionine incorporation. Subsequent phase improvement employed two-fold averaging using RESOLVE, followed by cross-crystal averaging with a non-isomorphous, less anisotropic, and slightly higher resolution dataset using DMMULTI .

Model building and refinement utilized a combination of automated and manual approaches. After phase improvement produced maps of sufficient quality, the majority of the structure could be built automatically with BUCCANEER . Model completion was performed manually in COOT, and the structure was refined with BUSTER using all data to 2.05 Å . The final model included residues 16-269 (chain B, 14-269), the covalently bound lipid, detergent molecules, and solvent molecules.

Alternative structural biology techniques that could complement X-ray crystallography for ELOVL7 and similar proteins include cryo-electron microscopy (cryo-EM), which has revolutionized membrane protein structure determination in recent years, and nuclear magnetic resonance (NMR) for studying protein dynamics and ligand interactions.

What is the biological significance of ELOVL7's impact on de novo androgen synthesis?

ELOVL7's influence on de novo androgen synthesis represents a significant connection between lipid metabolism and steroid hormone signaling. Research has shown that ELOVL7 affects cholesterol ester, which serves as a source for de novo steroid synthesis in prostate cancer cells . This finding has important biological and potentially therapeutic implications.

The mechanism likely involves ELOVL7's role in generating specific very-long-chain fatty acids that are incorporated into cholesterol esters. Changes in the fatty acid composition of these esters may affect their stability, metabolism, or availability for steroid synthesis. Given that prostate cancer growth is often androgen-dependent, ELOVL7's influence on de novo androgen synthesis provides a plausible mechanism for its pro-tumorigenic effects in prostate cancer .

This relationship between ELOVL7 and androgen synthesis highlights the integrated nature of lipid and steroid metabolism. It also reinforces observations from epidemiological studies that have indicated strong associations between dietary fat intake and prostate cancer development . ELOVL7 may represent a molecular link between these dietary factors and cancer progression through alteration of androgen metabolism.

From a therapeutic perspective, targeting ELOVL7 could potentially disrupt this pathway, offering a novel approach to treating androgen-dependent prostate cancers. This strategy would be particularly valuable for cases resistant to conventional androgen deprivation therapies, as it addresses an alternative source of androgens that may sustain tumor growth despite systemic hormone suppression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.