Recombinant Human Emerin (EMD)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Human Emerin (EMD)

Recombinant Human Emerin (EMD) is a manufactured version of the emerin protein, which in humans is encoded by the EMD gene located on the X chromosome . The EMD gene is also known as the STA gene . Emerin is a constituent of the inner nuclear membrane and is categorized as a LEM domain-containing integral protein found in vertebrates .

Gene and Protein Structure

The human emerin protein is composed of 254 amino acids, resulting in a molecular weight of approximately 29.0 kDa, though it is observed to be 34 kDa via experimentation . Emerin is rich in serine and contains a hydrophobic region at the N-terminus consisting of 20 amino acids . This hydrophobic region, bordered by charged residues, facilitates the protein's anchorage to the membrane, positioning the charged terminal tails within the cytosol . The mouse emerin gene (Emd) comprises six exons and encodes a protein of 259 amino acids with 73% identity to human emerin .

Expression and Localization

Emerin is expressed in most human tissues, with particularly high levels in cardiac and skeletal muscle . Within muscle cells, emerin is localized to the inner nuclear membrane . Specifically, in cardiac muscle, emerin is found at adherens junctions within intercalated discs, suggesting a role in mechanotransduction and beta-catenin signaling .

Function

Emerin plays multiple roles within the cell nucleus. It is a member of the nuclear lamina-associated protein family and mediates the anchorage of the nuclear membrane to the cytoskeleton . Furthermore, emerin binds to actin filaments and increases the actin polymerization rate . It interacts with various nuclear proteins, including lamins, MAN1, and barrier-to-autointegration factor (BAF) . These interactions suggest involvement in gene expression, nuclear assembly, cell cycle regulation, and nuclear envelope stabilization .

Role in Disease

Mutations in the EMD gene cause X-linked recessive Emery-Dreifuss muscular dystrophy (X-EDMD) . This disorder is characterized by slowly progressive muscle weakness, early joint contractures, and cardiomyopathy with conduction block . Studies involving emerin-lacking mice have demonstrated altered motor coordination and mild prolongation of atrioventricular conduction time, along with structural fragility of myonuclei .

Protein Interactions

Emerin interacts with a variety of proteins, which can be categorized into structural and functional partners.

Partner ProteinType of InteractionFunction/Relevance
Lamins A/CDirect binding Nuclear intermediate filaments; maintain structural integrity of the nucleus
Nesprin-1αBinding Spectrin-repeat membrane protein; structural or anchoring partner
Barrier-to-autointegration factor (BAF)Direct binding Chromatin protein; gene regulation
Germ cell-less (GCL)Direct binding Transcription repressor; gene regulation
BtfDirect binding Transcription repressor; gene regulation
YT521-BBinding mRNA-splicing factor; gene regulation
ActinBinding and stabilization Increases actin polymerization rate; structural integrity of the nuclear envelope

Research and Models

Studies using mutant mice lacking emerin have provided insights into the protein's function. These mice exhibit minimal motor and cardiac dysfunctions, along with structural fragility of myonuclei, suggesting that emerin deficiency leads to mechanical stress and structural defects in affected tissues .

Therapeutic Potential

Given emerin's role in genetic regulation and its involvement in Emery-Dreifuss muscular dystrophy, it is a potential therapeutic target. Databases such as the Human Epigenetic Enzyme and Modulator Database (HEMD) provide resources for identifying chemical modulators that can target epigenetic enzymes, including emerin, for therapeutic interventions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
EMD; EDMD; STA; Emerin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
EMD
Target Protein Sequence
MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYS FSDLNSTRGDADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQS VTSFPDADAFHHQVHDDDLLSSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLS YYPTSSSTSFMSSSSSSSSWLTRRAIRPENRAPGAGLGQDRQVPLWGQLLLFLVFVIVLF FIYHFMQAEEGNPF
Uniprot No.

Target Background

Function
Recombinant Human Emerin (EMD) stabilizes and promotes the formation of a nuclear actin cortical network. It stimulates actin polymerization in vitro by binding to and stabilizing the pointed end of growing filaments. EMD inhibits β-catenin activity by preventing its nuclear accumulation, influencing this accumulation through a CRM1-dependent export pathway. It links centrosomes to the nuclear envelope via microtubule association. EMD and BAF are cooperative cofactors in HIV-1 infection; EMD's association with viral DNA requires BAF and viral integrase, while viral DNA association with chromatin requires both BAF and EMD. EMD is also required for the proper localization of non-farnesylated prelamin-A/C.
Gene References Into Functions
  1. Emerin's crucial role in nuclear invagination and nuclear calcium transients in Emery-Dreifuss muscular dystrophy. PMID: 28290476
  2. Evaluation of emerin and CD56's diagnostic value in papillary thyroid carcinoma using immunohistochemistry. PMID: 30188764
  3. Samp1's significant attenuation of emerin mobility in the nuclear envelope; emerin mobility's dependence on RanGTP; and Ran's attenuation of the Samp1-Emerin interaction. PMID: 29510091
  4. Epstein-Barr virus early lytic protein BFRF1's alteration of emerin distribution and post-translational modifications. PMID: 28238874
  5. Emerin's negative regulation of Notch signaling by promoting NICD retention at the nuclear membrane. PMID: 27865926
  6. Conformational change in the LEM domain (during emerin N-terminal self-assembly) responsible for binding to the chromatin protein BAF. PMID: 27960036
  7. Occurrence of X-linked Emery-Dreifuss muscular dystrophy alongside dilative cardiomyopathy. PMID: 25502304
  8. Requirement of the LEM domain (residues 1-47) for emerin association with nuclear BAF in cells. PMID: 25052089
  9. EMD's novel role as an enhancer of autophagosome formation in the C16-ceramide autophagy pathway in colon cancer cells. PMID: 24819607
  10. Impact of mutations in EMD and TMPO genes (in combination with SUN1 mutations) on several components of the nuclear envelope network. PMID: 24375709
  11. Emerin's extensive characterization: biochemistry, partners, functions, localizations, post-translational regulation, roles in development, and links to human disease. PMID: 23873439
  12. Direct binding between the nucleoplasmic domains of Samp1 and Emerin. PMID: 24950247
  13. Novel EMD deletion causing rare clinical presentations, broadening the phenotypic spectrum of EMD mutations and providing insights into genotype-phenotype correlations. PMID: 24997722
  14. Selective reduction of GFP-emerin association with BAF by the S173D mutation. PMID: 24014020
  15. Kaposi's sarcoma-associated herpesvirus p29 expression's effects on emerin delocalization and hyperphosphorylation. PMID: 23623980
  16. Identification of an EMD gene mutation confirming X-linked recessive (XR) EDMD. PMID: 22480903
  17. Increase in the number of known EMD mutations. PMID: 21697856
  18. Functional interactions between 4.1R, emerin, and A-type lamin impacting nuclear architecture, centrosome-nuclear envelope association, and β-catenin regulation. PMID: 21486941
  19. Association of Mel18 with emerin in Hutchinson-Gilford progeria syndrome, but not in wild-type cells. PMID: 19727227
  20. Dynamic roles of BAF and emerin in genome integrity, coupling DNA damage responses to the nuclear lamina network. PMID: 19759913
  21. Possibility of Emery-Dreifuss-like dystrophy associated with mutations in genes other than EMD or LMNA. PMID: 20054742
  22. Emerin's role as a downstream effector and signal integrator for tyrosine kinase signaling pathways at the nuclear envelope. PMID: 19789182
  23. Disease-linked emerin proteins retaining activity for binding to barrier-to-autointegration factor (BAF), suggesting disease results from loss of emerin-lamin A interactions or interactions with novel partners. PMID: 11792821
  24. Genes responsible for Emery-Dreifuss muscular dystrophy. PMID: 11973618
  25. Emerin's direct binding to a transcriptional repressor, GCL, and regulation of emerin-repressor complexes by barrier to autointegration factor. PMID: 12493765
  26. Emerin's structural and regulatory roles in the cell nucleus. PMID: 12755701
  27. Potential role of the lamin A-emerin complex in muscular dystrophy and cardiomyopathy. PMID: 12783988
  28. Loss of emerin binding to Btf's relevance to muscle wasting in Emery-Dreifuss muscular dystrophy and Btf localization regulation by apoptotic signals. PMID: 15009215
  29. Mobility of barrier-to-autointegration factor and its partners (emerin, LAP2β, and MAN1) in the nuclear membrane of living HeLa cells. PMID: 15109603
  30. Emerin's potential disruption of transcription factors and nuclear envelope architecture by weakening a nuclear actin network. PMID: 15328537
  31. Direct binding of MAN1 to emerin in vitro. PMID: 15681850
  32. Ser-4 phosphorylation's inhibition of BAF binding to emerin and lamin A, weakening emerin-lamin interactions during mitosis and interphase. PMID: 16204256
  33. Lack of significant impact of emerin or A-type lamin mutations on chromosome positioning in lymphoblastoid cell lines. PMID: 16246140
  34. Epitope masking in the nucleus as a cause for failure to detect emerin in human and rat tissues. PMID: 16283426
  35. Ser-4 phosphorylation's inhibition of BAF binding to emerin and lamin A, weakening emerin-lamin interactions during both mitosis and interphase. PMID: 16371512
  36. Lamin A/C and emerin's critical role in skeletal muscle satellite cell differentiation; deficient cells display delayed differentiation kinetics potentially underlying dystrophic phenotypes. PMID: 16481476
  37. Emerin's necessity for HIV-1 infection. PMID: 16680152
  38. Emerin's architectural and gene-regulatory roles in the nucleus contributing to Emery-Dreifuss muscular dystrophy pathology and mechanism. PMID: 16761279
  39. Immunoreactivity of muscle vacuoles in inclusion-body myositis (IBM) for inner nuclear membrane proteins emerin and lamin A/C. PMID: 16823856
  40. Emerin's regulation of β-catenin nuclear flux. PMID: 16858403
  41. Contribution of altered nuclear envelope elasticity (due to emerin loss) to increased nuclear fragility in Emery-Dreifuss muscular dystrophy patients. PMID: 16997877
  42. Lmo7's positive regulation of EDMD-relevant genes (including emerin) and its feedback regulation by binding to emerin. PMID: 17067998
  43. Mislocalization of emerin to the endoplasmic reticulum in A-type lamin-deficient cells leading to its proteasome-mediated degradation. PMID: 17097067
  44. Absence of EMD or LMNA mutations in some families with EDMD-like phenotypes, implying other causative genes. PMID: 17117676
  45. Characterization of residues in emerin and nesprin-1α and -2β involved in their interaction. PMID: 17462627
  46. Synergistic effects of lamin A/C and emerin mutations leading to worsened Emery-Dreifuss muscular dystrophy via a digenic mechanism. PMID: 17536044
  47. EMD mutations potentially underlying limb-girdle muscular dystrophy phenotype; importance of identifying emerin deficiency to prevent cardiac complications. PMID: 17620497
  48. Hyperphosphorylation of emerin by pUS3 and PKCδ (recruited by pUL34), disrupting its connections with lamin proteins and contributing to nuclear lamina disruption. PMID: 17652388
  49. Emerin's significant presence at the outer nuclear membrane and peripheral ER, interacting directly with the centrosome. PMID: 17785515
  50. EMD mutation potentially underlying X-linked familial atrial fibrillation; Lys37del associated with epithelial cell emerin deficiency (similar to Emery-Dreifuss muscular dystrophy) causing electrical atriomyopathy without skeletal muscle disease. PMID: 18266676
Database Links

HGNC: 3331

OMIM: 300384

KEGG: hsa:2010

STRING: 9606.ENSP00000358857

UniGene: Hs.522823

Involvement In Disease
Emery-Dreifuss muscular dystrophy 1, X-linked (EDMD1)
Subcellular Location
Nucleus inner membrane; Single-pass membrane protein; Nucleoplasmic side. Nucleus outer membrane. Note=Colocalized with BANF1 at the central region of the assembling nuclear rim, near spindle-attachment sites. The accumulation of different intermediates of prelamin-A/C (non-farnesylated or carboxymethylated farnesylated prelamin-A/C) in fibroblasts modify its localization in the nucleus.
Tissue Specificity
Skeletal muscle, heart, colon, testis, ovary and pancreas.

Q&A

What is Emerin and what is its cellular localization?

Emerin is a ubiquitously expressed inner nuclear membrane protein of 254 amino acids with a molecular mass of approximately 34 kDa. It is primarily localized to the nuclear envelope where it functions as an integral component of the nuclear lamina structure. Wild-type emerin is typically found in the nuclear fraction and displays insolubility in non-ionic detergents and high salt conditions, which is characteristic of nuclear membrane proteins .

For researchers investigating emerin localization, subcellular fractionation followed by immunoblotting remains the gold standard approach. Importantly, studies of lymphoblastoid cell lines from Emery-Dreifuss muscular dystrophy (EDMD) patients have demonstrated that mutant forms of emerin exhibit aberrant subcellular distribution and increased solubility compared to wild-type protein, indicating that proper localization is critical for normal function .

What are the key structural domains in human Emerin that researchers should consider?

Human Emerin contains several functionally distinct domains that are critical for its various interactions and cellular functions:

  • The LEM domain (residues 1-47) is essential for binding to barrier-to-autointegration factor (BAF)

  • Residues 170-220 contain elements important for intermolecular emerin-emerin associations

  • Residues 187-220 function as a positive element essential for intermolecular association in cells

  • Residues 168-186 represent a negative regulatory element that limits or controls association

  • Emerin contains a sequence (PVSASR-SSL-DLS) in its C-terminal portion that resembles a consensus sequence in the adenomatous polyposis coli (APC) protein involved in β-catenin binding

  • Two independent regions (residues 1-132 and 159-220) are each sufficient to bind lamin A or B1 tails in vitro

For experimental characterization of these domains, deletion analysis combined with peptide binding arrays has proven highly effective in defining the specific regions involved in various molecular interactions.

What expression systems are most effective for producing recombinant human Emerin?

Several expression systems have been successfully utilized for recombinant human Emerin production, each with distinct advantages for different research applications:

  • Baculovirus-Sf9 insect cell heterologous expression system provides good yields for mass spectrometry and biochemical studies

  • Wheat germ expression systems can produce full-length human Emerin (amino acids 1-254) suitable for applications including SDS-PAGE, ELISA, peptide arrays, and Western blotting

  • In vitro coupled reticulocyte systems successfully express full-length recombinant human Emerin with a molecular mass of 34 kDa that can insert into microsomes in a type II orientation

The choice of expression system should be guided by the specific research requirements. For structural studies requiring post-translational modifications, insect or mammalian expression systems are preferable. For functional binding studies, bacterial expression may be sufficient for certain truncated domains.

How can phosphorylation states of Emerin be accurately characterized?

Emerin exists in at least four different phosphorylated forms, making characterization of its phosphorylation state crucial for functional studies. A methodological approach should include:

  • Mass spectrometry analysis of purified recombinant Emerin to identify phosphopeptides. Studies have identified three specific phosphopeptides with m/z values of 2191.9 and 2271.7 (corresponding to singly and doubly phosphorylated peptide 158-DSAYQSITHYRPVSASRSS-176), and 2396.9 (corresponding to phosphopeptide 47-RLSPPSSSAASSYSFSDLNSTR-68) .

  • Alkaline phosphatase treatment to dephosphorylate the protein, which can confirm phosphorylation and generate non-phosphorylated controls .

  • Sequence analysis to identify specific phosphorylated residues, such as serine 49 (S49) which has been confirmed to be phosphorylated during interphase .

  • In vitro kinase assays to identify kinases responsible for specific phosphorylation events. Protein kinase A (PKA) has been identified as the first kinase that specifically phosphorylates emerin at residue S49 .

Understanding these phosphorylation events is particularly important as three of the four phosphorylated forms appear to be associated with the cell cycle, and mutant forms of Emerin from EDMD patients exhibit aberrant cell cycle-dependent phosphorylation patterns .

What controls are essential when working with recombinant Emerin?

For rigorous experimental design when working with recombinant Emerin, several controls are essential:

  • Phosphorylation controls: Since Emerin exists in multiple phosphorylated forms, comparing phosphatase-treated versus untreated samples provides important functional controls .

  • Domain controls: For binding studies, isolated domains (e.g., LEM domain) should be used as controls to determine domain-specific interactions .

  • Protein fragment controls: For antibody validation, a 100x molar excess of the protein fragment control is recommended for blocking experiments with corresponding antibodies in IHC/ICC and WB. Pre-incubate the antibody-protein control fragment mixture for 30 minutes at room temperature .

  • Wild-type versus mutant controls: Well-characterized mutants, especially disease-associated mutations, serve as critical controls for functional studies and localization experiments .

  • Solubility controls: Testing solubility in different detergents and salt conditions can help distinguish between properly folded and misfolded protein, as wild-type Emerin is typically insoluble in non-ionic detergents and high salt .

How does Emerin contribute to nuclear envelope structure and function?

Emerin plays multiple critical roles in nuclear envelope structure and function through several mechanisms:

  • Nuclear lamina composition: Emerin functions as a conserved membrane component of the nuclear lamina structure, binding directly to lamins and barrier-to-autointegration factor (BAF) . These interactions contribute to nuclear envelope integrity and organization.

  • Nuclear-cytoskeletal connections: Emerin links centrosomes to the nuclear envelope via microtubule association, establishing connections between the nuclear and cytoskeletal networks .

  • Nuclear envelope stiffness: Together with NEMP1, Emerin contributes to nuclear envelope stiffness in germ cells, which may be particularly relevant for cells subject to mechanical stress .

  • Nuclear actin organization: Emerin stabilizes and promotes the formation of a nuclear actin cortical network by stimulating actin polymerization through binding and stabilizing the pointed end of growing filaments .

  • Lamin organization: Emerin is required for proper localization of non-farnesylated prelamin-A/C, indicating its role in organizing other nuclear envelope proteins .

These diverse functions explain why Emerin mutations can lead to complex disease phenotypes affecting multiple cellular processes, particularly in mechanically stressed tissues like muscle.

What is known about Emerin-Emerin intermolecular interactions?

Emerin exhibits complex self-association properties that are likely important for its function in organizing nuclear envelope structure. Detailed biochemical studies have revealed two distinct modes of intermolecular emerin-emerin association:

  • The first mode is mediated by association of residues 170-220 in one emerin molecule to residues 170-220 in another emerin molecule .

  • The second mode involves interaction between residues 170-220 and residues 1-132 .

Deletion analysis has provided further insight into the regulatory mechanisms of these interactions:

  • Residues 187-220 contain a positive element that is essential for intermolecular association in cells .

  • Deletion of residues 168-186 inactivates a negative regulatory element that normally limits or controls association, suggesting a sophisticated mechanism for regulating emerin network formation .

Emerin peptide arrays have revealed specific binding sites, including direct binding of residues 170-220 to residues 206-225 (the positive element), residues 147-174 (particularly P153MYGRDSAYQSITHYRP169), and the LEM domain .

These intermolecular interactions, combined with emerin's predicted intrinsic disorder, support a model where emerin forms multiple "backbone" configurations in an intermolecular network at the nuclear envelope .

How does Emerin regulate β-catenin activity and what are the implications for disease?

Emerin plays a critical role in regulating β-catenin activity through several mechanisms:

  • Nuclear exclusion: Emerin inhibits β-catenin activity by preventing its accumulation in the nucleus .

  • Export pathway: Emerin influences the nuclear accumulation of β-catenin through a CRM1-dependent export pathway .

  • Structural motif: The C-terminal portion of emerin contains a sequence (PVSASR-SSL-DLS) that bears striking similarity to a consensus sequence in the adenomatous polyposis coli (APC) tumor suppressor protein involved in β-catenin binding .

The pathological relevance of this regulatory function is demonstrated in fibroblasts from X-EDMD patients lacking emerin, which display massive nuclear accumulation of β-catenin . This accumulation leads to an autostimulatory growth phenotype that may contribute to the fibrotic tissue accumulation observed in both cardiac and skeletal muscle in X-EDMD patients .

Similar rapid growth phenotypes have been observed in mouse embryo fibroblasts from Lmna−/− mice (a model of EDMD), suggesting that both emerin and lamins A/C operate through convergent pathways to regulate cell proliferation .

What is the relationship between Emerin and BAF in health and disease?

Emerin and BAF (Barrier-to-Autointegration Factor) interact functionally in several cellular processes:

  • Nuclear structure: Emerin binds to BAF through its LEM domain (residues 1-47), forming part of the nuclear lamina structure .

  • Cellular localization: Association of GFP-Emerin with nuclear BAF in cells requires both the LEM domain and the positive element (residues 187-220) .

  • Cell cycle regulation: The interaction between Emerin and BAF is regulated through cell cycle-dependent phosphorylation of Emerin. During mitosis, phosphorylation of Emerin can lead to dissociation from BAF, as demonstrated in a Xenopus egg cell-free system .

  • Viral infection: EMD and BAF function as cooperative cofactors in HIV-1 infection. Association of EMD with viral DNA requires the presence of BAF and viral integrase, and the association of viral DNA with chromatin requires both BAF and EMD .

This cooperative relationship extends to pathological conditions, as mutations affecting either protein can disrupt their functional interaction. Understanding this relationship has implications not only for nuclear envelope disorders but also for potential therapeutic approaches targeting viral infections.

What methodological approaches best capture Emerin's dynamic interactions?

To effectively study Emerin's dynamic interactions, researchers should consider multiple complementary approaches:

  • For in vitro interactions: Recombinant protein binding assays using purified components can determine direct interactions and binding affinities. Emerin peptide arrays have been particularly effective in mapping binding sites with high resolution .

  • For phosphorylation studies: Mass spectrometry combined with in vitro kinase assays provides detailed information about phosphorylation sites and responsible kinases. Protein kinase A assays have successfully identified S49 as a specific phosphorylation site .

  • For cellular localization: Expression of GFP-tagged Emerin constructs in cells allows visualization of localization and dynamics. Association with nuclear BAF requires both the LEM domain and residues 187-220, highlighting the importance of using constructs with intact functional domains .

  • For protein-protein interactions: Co-immunoprecipitation combined with western blotting or mass spectrometry can identify interaction partners in cellular contexts. This approach has revealed interactions with lamins, BAF, and other nuclear envelope proteins .

  • For structural analysis: Given Emerin's predicted intrinsic disorder, techniques that can handle flexible proteins like nuclear magnetic resonance (NMR) spectroscopy may be more informative than crystallography.

How do mutations in the Emerin gene lead to X-linked Emery-Dreifuss muscular dystrophy?

Mutations in the emerin gene (EMD) give rise to X-linked Emery-Dreifuss muscular dystrophy (X-EDMD), a neuromuscular condition with an associated life-threatening cardiomyopathy . Several mechanisms have been proposed based on detailed cellular and molecular studies:

  • Aberrant localization: Studies of lymphoblastoid cell lines from EDMD patients demonstrate that mutant forms of emerin exhibit random subcellular localization rather than proper nuclear envelope targeting .

  • Altered solubility: Unlike wild-type emerin, which is insoluble in non-ionic detergents and high salt, mutant forms show increased solubility, suggesting disrupted integration into the nuclear lamina .

  • Disrupted nuclear targeting: Analysis of patient mutations indicates that emerin possesses two non-overlapping nuclear envelope targeting sequences, both of which are important for proper localization and function .

  • Abnormal phosphorylation: Mutant forms of emerin exhibit aberrant cell cycle-dependent phosphorylation patterns, suggesting disruption of normal regulatory mechanisms .

  • Dysregulated β-catenin signaling: Fibroblasts lacking emerin display massive nuclear accumulation of β-catenin, leading to an autostimulatory growth phenotype that may contribute to fibrotic tissue accumulation in muscle .

For emerin to function normally, it must be correctly localized, retained at the nuclear membrane, and appropriately phosphorylated by cell cycle-mediated events . Disruption of any of these aspects can contribute to disease pathogenesis.

How can recombinant Emerin be used to study potential therapeutic approaches?

Recombinant human Emerin serves as a valuable tool for developing and evaluating therapeutic strategies:

  • Structural studies: Purified recombinant emerin enables detailed structural analysis to identify protein domains that could be targeted by small molecules to stabilize mutant forms or enhance their function .

  • Phosphorylation modulation: Since emerin exists in multiple phosphorylated forms and protein kinase A specifically phosphorylates serine 49, kinase modulators could potentially normalize aberrant phosphorylation patterns in disease states .

  • Protein-protein interaction screening: Recombinant emerin can be used in high-throughput screens to identify compounds that enhance or disrupt specific protein interactions relevant to disease .

  • Cell-based assays: Introducing wild-type or mutant recombinant emerin into patient-derived cells allows evaluation of functional rescue and identification of compensatory pathways.

  • β-catenin pathway modulation: Given emerin's role in regulating β-catenin nuclear accumulation, compounds targeting this pathway could potentially address the abnormal cell proliferation observed in emerin-deficient cells .

  • BAF interaction enhancement: Since emerin and BAF cooperate in multiple cellular processes, strengthening this interaction pharmacologically could compensate for partial loss of function in some disease scenarios .

What is the relationship between Emerin deficiency and HIV-1 infection?

An intriguing aspect of Emerin biology is its role in HIV-1 infection. Research has revealed that:

  • Cooperative function: EMD and BAF are cooperative cofactors of HIV-1 infection .

  • Viral DNA association: Association of EMD with viral DNA requires the presence of both BAF and viral integrase .

  • Chromatin integration: The association of viral DNA with chromatin requires the presence of both BAF and EMD .

This relationship has several implications:

  • Individuals with emerin mutations might potentially have altered susceptibility to HIV-1 infection or disease progression.

  • Understanding the molecular basis of emerin's role in viral integration could lead to novel antiviral strategies.

  • The emerin-BAF interaction provides insight into normal chromatin organization and nuclear architecture functions of these proteins.

Research in this area represents an unexpected connection between a muscular dystrophy-associated protein and infectious disease, highlighting the diverse functional roles of nuclear envelope proteins.

What technical challenges should researchers anticipate when working with recombinant Emerin?

Researchers working with recombinant human Emerin should be prepared to address several technical challenges:

  • Post-translational modifications: Emerin exists in at least four different phosphorylated forms, and these modifications are likely important for function . Expression systems should be chosen carefully based on their ability to replicate relevant modifications.

  • Membrane association: As an inner nuclear membrane protein, full-length emerin contains a transmembrane domain that can complicate expression and purification . Some applications may benefit from using soluble fragments lacking this domain.

  • Protein-protein interactions: Emerin participates in numerous protein interactions, including self-association, which can lead to aggregation during purification . Buffer conditions should be optimized to maintain solubility without disrupting functional interactions.

  • Structural disorder: Predicted intrinsic disorder in emerin may complicate structural studies and necessitate techniques suitable for flexible proteins .

  • Expression system selection: Different expression systems (baculovirus-Sf9, wheat germ, reticulocyte lysate) yield recombinant emerin with different properties and may be more suitable for specific applications .

  • Verification methods: Confirming the identity and activity of purified recombinant emerin requires multiple approaches, including mass spectrometry, phosphorylation analysis, and binding assays with known partners like lamins and BAF .

How can researchers effectively study the dynamic phosphorylation of Emerin?

Studying emerin phosphorylation requires a multifaceted approach:

  • Mass spectrometry: This technique has successfully identified specific phosphopeptides in recombinant human emerin, with m/z values of 2191.9 and 2271.7 corresponding to singly and doubly phosphorylated peptide 158-DSAYQSITHYRPVSASRSS-176, and 2396.9 corresponding to phosphopeptide 47-RLSPPSSSAASSYSFSDLNSTR-68 .

  • Phosphatase treatment: Alkaline phosphatase treatment can dephosphorylate all four phosphorylated species of emerin, providing important controls for phosphorylation-dependent activities .

  • Sequence analysis: Direct sequencing has confirmed phosphorylation at residue S49 during interphase .

  • In vitro kinase assays: Protein kinase A assays have identified two phospho-emerin species, including phosphorylation at S49 .

  • Cell cycle studies: Since three of the four phosphorylated forms appear to be cell cycle-dependent, synchronizing cells at different cell cycle stages can reveal regulation patterns .

  • Comparison of wild-type and mutant forms: Mutant forms of emerin from EDMD patients exhibit aberrant cell cycle-dependent phosphorylation, providing insight into disease mechanisms .

This multimodal approach enables researchers to connect specific phosphorylation events with functional outcomes and disease pathology.

What experimental design considerations are crucial when studying Emerin interactions with β-catenin?

When investigating the regulatory relationship between emerin and β-catenin, several experimental design considerations are critical:

  • Cell type selection: The effect of emerin on β-catenin may vary by cell type, so comparing results across multiple cell types is important. Fibroblasts from X-EDMD patients have shown massive nuclear accumulation of β-catenin, making them particularly valuable models .

  • Subcellular fractionation: Since emerin regulates β-catenin through influencing its nuclear accumulation, proper separation of nuclear and cytoplasmic fractions is essential .

  • Export pathway analysis: Emerin influences β-catenin through a CRM1-dependent export pathway, so experiments using CRM1 inhibitors like leptomycin B can help elucidate the mechanism .

  • Growth phenotype assessment: The autostimulatory growth phenotype observed in emerin-null fibroblasts provides a functional readout for β-catenin activity .

  • Comparative analysis: Comparing findings between X-EDMD (emerin mutations) and autosomal EDMD (lamin A/C mutations) models can reveal convergent pathways, as similar growth phenotypes have been observed in both .

  • Binding site investigation: The C-terminal portion of emerin contains a sequence (PVSASR-SSL-DLS) similar to a β-catenin binding consensus in APC, which merits specific investigation in interaction studies .

How can researchers assess the functionality of recombinant Emerin in experimental systems?

To assess the functionality of recombinant human Emerin, researchers should employ multiple complementary approaches:

  • Subcellular localization: Wild-type emerin should localize to the nuclear fraction when expressed in cells, while mutant forms may show more random subcellular localization .

  • Solubility properties: Functional wild-type emerin is insoluble in non-ionic detergents and high salt, providing a biochemical test of proper membrane integration .

  • Phosphorylation status: Verification of the four different phosphorylated forms using mass spectrometry or phospho-specific antibodies confirms proper post-translational modification .

  • Protein interactions: Binding assays with known partners such as lamins, BAF, and self-association can confirm functional conformation .

  • Actin polymerization: Since emerin stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments, actin assembly assays provide a functional readout .

  • β-catenin regulation: The ability to prevent nuclear accumulation of β-catenin through a CRM1-dependent export pathway represents another functional assessment .

  • Rescue experiments: The ability of recombinant emerin to rescue phenotypes in emerin-null or emerin-mutant cells provides the most stringent test of functionality.

What are the most significant recent advances in Emerin research?

Recent significant advances in Emerin research have expanded our understanding of this nuclear envelope protein beyond its structural role:

  • Identification of protein kinase A as the first kinase specifically phosphorylating emerin at serine 49, providing insight into regulatory mechanisms .

  • Characterization of complex emerin-emerin intermolecular interactions, revealing two distinct association modes and regulatory elements that control self-assembly .

  • Discovery of emerin's role in regulating β-catenin activity by preventing its nuclear accumulation through a CRM1-dependent export pathway, linking nuclear envelope function to cell proliferation control .

  • Identification of emerin's contribution to nuclear envelope stiffness in conjunction with NEMP1, highlighting its mechanical role .

  • Elucidation of emerin and BAF as cooperative cofactors in HIV-1 infection, revealing unexpected connections to viral pathogenesis .

These advances collectively portray emerin as a multifunctional protein at the interface of nuclear structure, signaling regulation, mechanical response, and host-pathogen interactions, rather than simply a structural component of the nuclear envelope.

What are the most pressing questions for future Emerin research?

Several critical questions remain to be addressed in future Emerin research:

  • How do specific phosphorylation events functionally regulate emerin's diverse interactions and activities?

  • Can pharmacological modulation of emerin phosphorylation or interactions represent viable therapeutic approaches for X-EDMD?

  • What is the structural basis for emerin self-assembly and how does this contribute to nuclear envelope organization?

  • How do emerin and lamins functionally cooperate, and why do mutations in either cause such similar disease phenotypes?

  • Can the β-catenin regulatory function of emerin be leveraged therapeutically to address the fibrotic aspects of EDMD?

  • How does emerin contribute to mechanotransduction in muscle cells, and how do defects in this function contribute to muscular dystrophy?

  • What is the complete interactome of emerin, and how do these interactions change during development, differentiation, and aging?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.