Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human ERGIC3

Recombinant Human ERGIC3 is a synthetic protein engineered to mimic the structure and function of the native ERGIC3 protein, a 43-kDa component of the ER-Golgi intermediate compartment (ERGIC). ERGIC3 (Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 3), also known as ERp43, is critical for regulating secretory protein trafficking between the ER and Golgi apparatus. Recombinant ERGIC3 is produced via E. coli expression systems and purified to >95% homogeneity .

Functional Roles of ERGIC3

ERGIC3 facilitates ER-to-Golgi transport and interacts with secretory proteins to modulate cell growth, survival, and immune responses. Key functions include:

  • Secretory Pathway Regulation: Binds to COPII vesicles and regulates trafficking of gap junction proteins (e.g., connexins and innexins) and serum proteins like alpha1-antitrypsin and haptoglobin .

  • Cancer Progression: Overexpression promotes proliferation, epithelial-mesenchymal transition, and metastasis in lung, liver, and colorectal cancers .

  • Immune Modulation: Correlates with tumor immune infiltration (e.g., CD8+ T cells, macrophages) and influences extracellular protein secretion .

  • Structural Interactions: Forms complexes with ERGIC2 and MARCH2 to regulate protein retrieval and ubiquitination .

Recombinant ERGIC3: Production and Applications

Recombinant ERGIC3 is used in research to study its mechanistic roles in disease.

PropertyDetailsSource
Expression SystemE. coli (aa 47–341 or 156–228 fragments)
Purity>95% (SDS-PAGE, MS validated)
ApplicationsSDS-PAGE, Western blot, blocking assays, structural studies, co-IP
Molecular Weight43 kDa (native), 50 kDa (observed due to post-translational modifications)

Role in Cancer Pathways

  • Lung Cancer: Knockdown of ERGIC3 induces ER stress, autophagic cell death, and inhibits tumor growth in K-ras LA1 mice .

  • Hepatocellular Carcinoma (HCC): ERGIC3 depletion reduces cell proliferation and immune evasion markers (e.g., upregulation of HORN) .

  • Proteomic Profiling: ERGIC3 knockdown alters 88 intracellular and 52 extracellular proteins, including cytokinesis regulators and secreted growth factors .

Immune Function and Secretion

  • Tumor Microenvironment: High ERGIC3 expression correlates with reduced CD8+ T cell infiltration in HCC .

  • Secretion Defects: MARCH2-mediated ubiquitination of ERGIC3 impairs secretion of alpha1-antitrypsin and haptoglobin; ubiquitination-resistant variants restore function .

Table 1: ERGIC3 Knockdown Effects in Lung Cancer Cells (GLC-82)

ParameterERGIC3i GroupControl GroupSignificance
Intracellular DEPs88 (41↑, 47↓)N/Ap < 0.05
Extracellular DEPs52 (33↑, 19↓)N/Ap < 0.05
ER Stress Markers↑ (e.g., CHOP)N/A
Tumor Growth↓ (in vivo models)N/A

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
2310015B14Rik; AV318804; C20orf47; CGI 54; D2Ucla1; dJ477O4.2; DKFZp547A2190; Endoplasmic reticulum Golgi intermediate compartment protein 3; endoplasmic reticulum localized protein ERp43; Endoplasmic reticulum-Golgi intermediate compartment protein 3; ERGI3_HUMAN; ERGIC and golgi 3; ergic3; ERV46; NY BR 84; PRO0989; RP23-220D12.2; RP3-477O4.1; SDBCAG84; Serologically defined breast cancer antigen 84; Serologically defined breast cancer antigen NY BR 84; Serologically defined breast cancer antigen NY-BR-84
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ERGIC3
Target Protein Sequence
MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYV DKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAE RHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIE QCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNI NMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAG LIDSLIYHSARAIQKKIDLGKTT
Uniprot No.

Target Background

Function
Putative role in endoplasmic reticulum-Golgi transport.
Gene References Into Functions

Functional Studies of ERGIC3:

  1. ERGIC3 knockdown induces endoplasmic reticulum stress-mediated autophagic cancer cell death. (PMID: 27588471)
  2. miR-203a downregulation leads to ERGIC3 overexpression in non-small cell lung cancer cells. (PMID: 26177443)
  3. ERGIC3 may actively participate in lung cancer development and progression. (PMID: 23374247)
  4. miR-490-3p regulates hepatocellular carcinoma cell growth and epithelial-to-mesenchymal transition by targeting ERGIC3. (PMID: 23212913)
  5. ERGIC3 plays a crucial role in cell growth and endoplasmic reticulum stress-induced cell death. (PMID: 17020792)
Database Links

HGNC: 15927

KEGG: hsa:51614

STRING: 9606.ENSP00000349970

UniGene: Hs.472558

Protein Families
ERGIC family
Subcellular Location
Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=Cycles between the endoplasmic reticulum and the Golgi.

Q&A

What is ERGIC3 and what is its role in cellular function?

ERGIC3 is a human ER-related 43-kDa protein (ERp43) that localizes primarily to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), a dynamic and mobile early secretory pathway positioned between the ER and Golgi apparatus in mammalian cells . This protein plays a critical role in membrane trafficking within the early secretory pathway.

When studying ERGIC3 function, researchers should consider its subcellular distribution through immunofluorescence microscopy. Under normal conditions, ERGIC3 typically displays a reticular distribution pattern consistent with ER localization, but under ER stress conditions, its localization pattern may change, with partial localization to the ER . For comprehensive functional analysis, researchers should examine ERGIC3 using multiple organelle markers, particularly under different cellular conditions.

How does ERGIC3 contribute to ER-Golgi trafficking?

ERGIC3 is directly involved in membrane trafficking between the ER and Golgi apparatus. Experimental evidence indicates that ectopically expressed RTN3 (Reticulon 3, a related ER-associated protein) exhibits heterogeneous patterns - filamentous, reticular, and granular distributions - with corresponding changes in ER morphology . Similarly, ERGIC3 affects this trafficking pathway, and its overexpression or knockdown can significantly alter protein transport between these compartments.

When ERGIC3 expression is altered, researchers should assess the following parameters:

  • Changes in ER morphology

  • Trafficking rates of model cargo proteins

  • Distribution of ERGIC-53 (an ERGIC marker) and other compartment-specific markers

  • Effects on retrograde transport (Golgi-to-ER movement)

Notably, in cells where filamentous/reticular distribution patterns are observed, protein transport between the ER and Golgi is typically blocked, and Golgi proteins become dispersed .

What experimental techniques are most effective for studying ERGIC3 localization?

To effectively study ERGIC3 localization, researchers should employ multiple complementary approaches:

  • Immunofluorescence microscopy: Using ERGIC3-specific antibodies with co-staining for ER markers (e.g., calnexin, RPN1), ERGIC markers (ERGIC-53/LMAN1, SEC22B), and Golgi markers (GM130/GOLGA2)

  • Subcellular fractionation: Differential centrifugation protocols can separate cellular components based on size and density. A recommended protocol involves:

    • Sequential centrifugation at 1,000×g (10 min), 3,000×g (10 min), 25,000×g (20 min), and 100,000×g (30 min)

    • Further purification of the 25,000×g fraction (which shows highest ERGIC activity) using sucrose gradient centrifugation

  • Electron microscopy: For high-resolution analysis of ERGIC3's precise localization

  • Live-cell imaging: Using fluorescently tagged ERGIC3 to monitor dynamic changes in localization and trafficking

What is the relationship between ERGIC, ERGIC3, and autophagosome formation?

The ERGIC has been identified as a key membrane source for autophagosome formation, with significant implications for understanding ERGIC3's potential role in this process. Research has demonstrated that:

  • ERGIC membranes are both necessary and sufficient to trigger LC3 lipidation, a critical step in autophagosome formation

  • The ERGIC acts by recruiting ATG14, an essential molecule for the generation of preautophagosomal membranes

  • Disruption of the ERGIC using pharmacological agents (H89, clofibrate) or genetic approaches (SAR1A mutants) prevents autophagosome formation

For researchers investigating ERGIC3's role in autophagy, consider examining:

  • ERGIC3's interaction with key autophagy proteins (ATG proteins, particularly ATG14)

  • The effect of ERGIC3 knockdown on LC3 lipidation using cell-free assays

  • How ERGIC3 manipulation affects the recruitment of DFCP1 and ATG14 to puncta in starved cells

  • Whether ERGIC3 is required for the PI3K activity necessary for autophagosome biogenesis

How does ERGIC3 contribute to cancer progression and pathogenesis?

ERGIC3 has emerged as a potential oncogenic factor, with significant implications for cancer research. Key findings include:

  • ERGIC3 is overexpressed in multiple cancer types, including lung adenocarcinoma (Grade I, II, and III), hepatocellular carcinomas, and colorectal tumors

  • Western blot analysis of human tissue samples (five samples per group) demonstrates progressively increasing ERGIC3 expression from normal lung tissue through higher grades of lung adenocarcinoma

  • ERGIC3 overexpression promotes cancer cell growth and reduces ER stress-mediated cell death

  • Knockdown of ERGIC3 leads to ER stress-induced autophagic cell death and suppression of proliferation in lung cancer cells (specifically the A549 human lung cancer cell line)

  • ERGIC3 correlates with cell proliferation, migration, and epithelial-mesenchymal transition in cancer cells

For cancer researchers studying ERGIC3, consider these methodological approaches:

  • Compare ERGIC3 expression levels between normal and tumor tissues using immunohistochemistry and Western blotting

  • Assess the impact of ERGIC3 knockdown on cancer cell viability, proliferation, and migration

  • Investigate the relationship between ERGIC3 expression and ER stress pathways in cancer cells

  • Evaluate ERGIC3 as a potential biomarker for cancer progression or prognosis

What are the most effective strategies for ERGIC3 knockdown in experimental systems?

Based on successful experimental approaches, researchers have employed several strategies for ERGIC3 knockdown:

  • shRNA-mediated knockdown: Short hairpin RNA (shERGIC3) has been effectively used both in vitro and in vivo to suppress ERGIC3 expression

  • Non-invasive aerosol delivery: For in vivo lung cancer models, aerosol delivery of shERGIC3 using biocompatible carriers like glycerol propoxylate triacrylate and spermine (GPT-SPE) has proven effective in inhibiting lung tumorigenesis in the K-ras LA1 murine model of lung cancer

  • siRNA transfection: Standard siRNA approaches can be used for transient knockdown in cell culture systems

  • CRISPR-Cas9 genome editing: For complete gene knockout studies

When designing knockdown experiments, researchers should:

  • Include appropriate controls (scrambled shRNA/siRNA)

  • Validate knockdown efficiency at both mRNA and protein levels

  • Consider the potential compensatory mechanisms from related family members

  • Monitor for off-target effects

How does ERGIC3 influence ER stress responses?

ERGIC3 has significant interactions with ER stress pathways, which has important implications for understanding cellular homeostasis and disease:

  • Overexpression of ERGIC3 significantly reduces ER stress-mediated cell death

  • ERGIC3 is localized to the ER under normal conditions but shows partial localization to the ER under ER stress conditions

  • Knockdown of ERGIC3 leads to ER stress-induced autophagic cell death

For researchers investigating this relationship:

  • Monitor canonical ER stress markers (CHOP, BiP/GRP78, XBP1 splicing) when manipulating ERGIC3 levels

  • Assess the three branches of the unfolded protein response (PERK, IRE1, ATF6) when ERGIC3 is overexpressed or depleted

  • Determine whether ERGIC3's effects on ER stress are direct or indirect through its role in membrane trafficking

  • Investigate whether ERGIC3 interacts directly with ER stress sensors or effectors

What cell-free assays can be used to study ERGIC3's role in membrane trafficking?

Researchers have developed sophisticated cell-free assays to study the role of ER-Golgi intermediate compartment proteins in membrane trafficking. A particularly valuable assay centers on LC3 lipidation to define the organelle membrane supporting early autophagosome formation:

  • Membrane preparation protocol:

    • Differential centrifugation to separate cellular membranes (1,000×g, 3,000×g, 25,000×g, and 100,000×g fractions)

    • Measurement of phosphatidylcholine (PC) levels in each fraction to normalize lipidation activity

    • Further purification using sucrose gradient ultracentrifugation to separate light (L) fraction and pellet (P) fraction

  • Specific activity determination:

    • Calculate specific activity by measuring lipidation activity normalized to equal amounts of PC

    • Calculate total activity by multiplying specific activity by PC level

  • Immunoisolation:

    • Use antibodies against SEC22B or KDEL receptor (KDELR) to isolate ERGIC-positive membranes

    • Test the immunoisolated membranes in the in vitro lipidation assay

This methodology revealed that ERGIC-enriched membranes show the highest specific activity for LC3 lipidation, providing a powerful tool for investigating ERGIC3's functional roles.

What are the optimal conditions for producing recombinant human ERGIC3 for research purposes?

While the provided search results don't explicitly describe recombinant ERGIC3 production, based on standard protocols for similar transmembrane proteins, researchers should consider:

  • Expression Systems:

    • Mammalian expression systems (HEK293, CHO cells) are preferred for proper folding and post-translational modifications

    • Insect cell systems (Sf9, High Five) using baculovirus expression vectors

    • Cell-free protein synthesis systems for small-scale production

  • Purification Strategy:

    • Affinity tags (His, FLAG, or GST) should be added, preferably to the N-terminus to avoid interference with C-terminal trafficking signals

    • Two-step purification (affinity chromatography followed by size exclusion)

    • Detergent selection is critical for membrane protein solubilization (mild detergents like DDM or LMNG are recommended)

  • Quality Control:

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography to verify monodispersity

    • Functional assays to confirm proper folding

What in vivo models are most appropriate for studying ERGIC3 function?

Based on successful experimental approaches documented in the literature:

  • Mouse models for cancer research:

    • The K-ras LA1 murine model of lung cancer has been effectively used to study ERGIC3's role in tumorigenesis

    • Xenograft models using cancer cell lines with ERGIC3 manipulation

  • Delivery methods for genetic manipulation:

    • Non-invasive aerosol delivery of shERGIC3 using biocompatible carriers like glycerol propoxylate triacrylate and spermine (GPT-SPE) has proven effective for lung-targeted studies

    • Systemic delivery via nanoparticles for broader tissue distribution

  • Assessment metrics:

    • Tumor burden quantification

    • Histopathological analysis

    • Measurement of ER stress markers

    • Analysis of autophagic activity

What are the emerging therapeutic applications of targeting ERGIC3?

The research on ERGIC3 indicates several promising therapeutic directions:

  • Cancer therapy:

    • Targeted suppression of ERGIC3 could provide a framework for developing effective lung cancer therapies

    • Combination approaches with ER stress inducers might enhance cancer cell death

    • Development of small molecule inhibitors of ERGIC3 function

  • Delivery mechanisms:

    • Aerosol delivery using biocompatible carriers has shown promise for lung-targeted therapies

    • Nanoparticle formulations for systemic delivery

    • Exosome-based delivery systems

  • Biomarker development:

    • ERGIC3 expression levels could serve as prognostic markers in various cancers

    • Monitoring ERGIC3 expression might help predict treatment response

Future research should focus on developing specific inhibitors of ERGIC3 function and testing their efficacy in preclinical models of various cancer types.

How might ERGIC3 function in neurodegenerative diseases?

While not directly addressed in the provided search results, the role of ERGIC in membrane trafficking and ER stress suggests potential implications for neurodegenerative diseases:

  • Given that ER stress is a common feature in neurodegenerative diseases (Alzheimer's, Parkinson's, ALS), ERGIC3's role in modulating ER stress responses may be relevant

  • The connection between ERGIC and autophagosome formation suggests ERGIC3 might influence autophagy-dependent clearance of protein aggregates

  • Reticulons (related ER-shaping proteins) have been implicated in axonal regeneration , suggesting potential neurological functions for ERGIC3

Researchers interested in this area should consider:

  • Examining ERGIC3 expression in brain tissues from neurodegenerative disease models

  • Investigating whether ERGIC3 manipulation affects the accumulation of disease-associated protein aggregates

  • Studying potential interactions between ERGIC3 and neurodegenerative disease-associated proteins

What are the key challenges in studying ERGIC3 interactions and function?

Researchers face several technical challenges when investigating ERGIC3:

  • Subcellular localization complexity:

    • ERGIC3 can display heterogeneous distribution patterns (filamentous, reticular, granular)

    • Its localization changes under different cellular conditions, particularly ER stress

    • Requires multiple markers to accurately track its distribution

  • Functional redundancy:

    • ERGIC3 may have overlapping functions with other ER-Golgi trafficking proteins

    • Compensatory mechanisms may mask phenotypes in knockdown experiments

  • Technical difficulties:

    • As a membrane protein, ERGIC3 can be challenging to purify in its native conformation

    • Antibody specificity issues may complicate detection

    • Distinguishing direct vs. indirect effects on membrane trafficking requires sophisticated assays

To address these challenges, researchers should:

  • Use multiple complementary approaches (genetics, biochemistry, microscopy)

  • Include appropriate controls in all experiments

  • Consider conditional and tissue-specific knockdown/knockout systems

  • Employ emerging technologies like proximity labeling to identify interaction partners

What standardized protocols exist for quantifying ERGIC3 expression levels?

For accurate quantification of ERGIC3 expression:

  • Western blotting:

    • Use validated antibodies against ERGIC3

    • Include appropriate loading controls (β-actin, GAPDH)

    • Employ quantitative analysis software for densitometry

    • Present data as fold change relative to control samples

  • qRT-PCR:

    • Design primers specific to ERGIC3 mRNA

    • Validate primer efficiency using standard curves

    • Use multiple reference genes for normalization

    • Calculate relative expression using the 2^-ΔΔCt method

  • Immunohistochemistry scoring:

    • Establish clear scoring criteria for staining intensity

    • Use automated image analysis when possible

    • Present data as H-scores or similar quantitative metrics

These standardized approaches allow for comparison across different studies and experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.