Recombinant Human Endothelin-1 receptor (EDNRA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Physiology and Pathology

EDNRA’s activation via ET-1 triggers:

  1. Vasoconstriction: Mediates blood pressure regulation and vascular tone .

  2. Proliferation: Promotes smooth muscle cell growth in cardiovascular diseases .

  3. Inflammation: Linked to renal injury and fibrosis in hypertension models .

Disease Associations:

ConditionMechanismEvidence
AneurysmsEDNRA polymorphisms (rs6841581) increase intracranial aneurysm risk .Meta-analyses show EDNRA variants correlate with aneurysmal pathogenesis.
Portal HypertensionEDNRA mRNA downregulation in cirrhotic portal veins .ET-A antagonists (e.g., ambrisentan) reduce portal pressure in preclinical models.
Bladder CancerHigh EDNRA expression predicts metastasis and poor prognosis .Tissue microarray studies validate EDNRA as a prognostic biomarker.

Drug Development

EDNRA antagonists (e.g., atrasentan, ambrisentan) inhibit ET-1 binding, reducing vasoconstriction and fibrosis .

  • Preclinical Models: Inducible endothelial ET-1 overexpression in mice reveals EDNRA’s role in hypertension .

  • Therapeutic Validation:

    • Ambrisentan: Competitive ET-A antagonist (pA₂ = 7.07 in human portal veins) .

    • Sparsentan: Dual ET-A/angiotensin II inhibitor approved for IgA nephropathy .

Diagnostic Assays

ELISA Kits:

ParameterDetailSource
Sensitivity0.093 ng/mL
Detection Range0.156–10 ng/mL
Sample CompatibilitySerum, plasma, cell culture supernatants

Notes:

  • Used to quantify EDNRA in disease tissues or drug response studies .

  • Sandwich ELISA format ensures specificity for recombinant and endogenous EDNRA .

Genetic and Functional Variability

Polymorphisms in EDNRA influence disease susceptibility:

  • Protective Role: Certain SNPs reduce vitiligo and migraine risk .

  • Pathogenic Role: rs6841581 (near EDNRA) increases aneurysm risk by altering ET-1 signaling .

Functional Implications:

  • Upregulation: ET-1 overexpression in endothelial cells induces sustained hypertension and renal damage .

  • Downregulation: Observed in portal hypertension, potentially as an adaptive response to elevated ET-1 .

Product Specs

Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5%-50% glycerol. Please specify your glycerol requirement in order notes if different from the default.
Form
Delivery format is either liquid or lyophilized powder. While we prioritize shipping the available format, please specify your preference in order notes to ensure fulfillment of your specific needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Our default glycerol concentration is 50%.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
Synonyms
EDNRA; ETA; ETRA; Endothelin-1 receptor; Endothelin receptor type A; ET-A; ETA-R; hET-AR
Datasheet & Coa
Please contact us to get it.
Expression Region
21–427aa
Mol. Weight
49.9kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
The endothelin-1 receptor (EDNRA) is a G protein-coupled receptor that mediates the actions of endothelin-1 by activating a phosphatidylinositol-calcium second messenger system. Its binding affinity for endothelin peptides follows the order: ET-1 > ET-2 >> ET-3.
Gene References Into Functions
  • Study on the lack of association between EDNRA rs5335 and large artery stroke risk in a Ukrainian population (PMID: 29849817)
  • Investigation into miR200c's regulation of gastric carcinoma cell proliferation, apoptosis, and invasion via EDNRA downregulation (PMID: 29286062)
  • Analysis of the increased expression of SST5, CXCR4, and ETA on tumor cells, and SST3, CXCR4, and ETA on microvessels, in correlation with tumor grade (PMID: 29696364)
  • Study demonstrating no association between the C+70G polymorphism of the EDNRA gene and ischemic atherothrombotic stroke (PMID: 29064794)
  • Research on the role of endothelin-A receptor-activated ABCB1 expression in nintedanib resistance in FGFR1-driven small cell lung cancer (PMID: 27367030)
  • Examination of endothelin-1's anti-apoptotic effect in vascular endothelial cells, mediated primarily through EDNRB activation, with minor contribution from EDNRA (PMID: 28732172)
  • Study identifying the presence of ETA and ETB receptors in human hemorrhoids, with ETB receptors predominating (PMID: 28095606)
  • Research indicating that ETAR stimulation suppresses the Hippo pathway via G-protein Galphaq/11 and Rho GTPase, leading to YAP/TAZ activation and ETAR-induced tumorigenesis (PMID: 28249901)
  • Study showing that ETAR drives invadopodia function through the interaction of beta-arrestin-1 with PDZ-RhoGEF (PMID: 26522724)
  • Analysis of ETAR and ETBR expression in giant cell arteritis, showing expression by vascular smooth muscle cells, endothelial cells, and inflammatory cells (PMID: 28606962)
  • Investigation into TNFalpha's induction of airway smooth muscle cell proliferation via ET1, GM-CSF, and IL6 signaling, with ET1 acting through ETAR and ETBR upregulation by TNFalpha (PMID: 27422754)
  • Study suggesting a role of ET-1 in stimulating smooth muscle cell proliferation within chronic thrombi in chronic thromboembolic pulmonary hypertension (CTEPH) (PMID: 26874031)
  • Research demonstrating that ACS-associated mutations in GNAI3 produce dominant-negative Galpha(i3) proteins that couple to ET(A)R (PMID: 27072656)
  • Study observing reduced ETAR/ETBR ratio in patients with lung fibrosis and high modified Rodnan skin score (PMID: 26773103)
  • Association of high ETAR expression with ovarian carcinoma (PMID: 26675258)
  • Research showing macitentan's interference with the profibrotic action of TGF-beta by blocking the ET-1 receptor portion of the ET-1/TGF-beta receptor complex (PMID: 26357964)
  • Study showing increased Ednra expression in Systemic Capillary Leak Syndrome blood-outgrowth endothelial cells compared to healthy controls (PMID: 26176954)
  • Genebased analyses revealing associations of EDNRA with blood pressure phenotypes, essential hypertension, blood pressure salt sensitivity, preeclampsia, and preclinical atherosclerosis (PMID: 25424718)
  • Study demonstrating the detection of endothelin A receptor in squamous cell carcinoma and psoriasis, with higher expression than in controls and basal cell carcinoma (PMID: 25946671)
  • Study quantifying the density of ETA and ETB receptors in cardiopulmonary tissue from pulmonary arterial hypertension patients and in a monocrotaline rat model (PMID: 24582810)
  • Research suggesting a role for agonistic autoantibodies in immune cell activation mediated by AT1R and ETAR in systemic sclerosis pathogenesis (PMID: 24612997)
  • Association of EDNRA polymorphisms with group I pulmonary hypertension, dilated cardiomyopathy, and essential hypertension (PMID: 24570333)
  • Study linking EDNRA mutations to mandibulofacial dysostosis with alopecia (PMID: 25772936)
  • Identification of significant SNP associations with birth weight near coding regions for PRKAA1 and EDNRA (PMID: 25225183)
  • Study showing no significant association between EDNRA (C+70G, G-231A) allele and Hashimoto's thyroiditis in a Turkish population (PMID: 24815860)
  • Research showing that upon ET-1 stimulation, ETAR is recycled to the plasma membrane, while ETBR is targeted for lysosomal degradation (PMID: 25381251)
  • Study suggesting a functional link between endothelin receptor autoantibody formation and down-regulated midkine serum levels in peripheral artery occlusive disease (PMID: 25056169)
  • Genetic association study suggesting an association between an SNP in EDNRA (rs5335) and congenital absence of the vas deferens (PMID: 24958810)
  • Research revealing a novel mechanism by which ETAR/beta-arr1 signaling is integrated with the Wnt/beta-catenin pathway to sustain chemoresistance in epithelial ovarian cancer (PMID: 25377471)
  • Study showing no association between Graves' disease and a genetic polymorphism (PMID: 24291390)
  • Observation of increased EDNRA mRNA expression in reflux esophagitis and Barrett's esophagus compared to controls (PMID: 23384184)
  • Study suggesting that ETAR and CXCR4 expression levels are potential prognostic biomarkers in nasopharyngeal carcinoma patients (PMID: 23987636)
  • Association of EDNRA mutation with ACTH-independent macronodular adrenal hyperplasia (PMID: 23754170)
  • Study describing the distribution of ET-1, ETA, and ETB polymorphisms in a population with aneurysmal subarachnoid hemorrhage (PMID: 22997346)
  • Research showing that ETAR overexpression promoted colon cancer liver metastases (PMID: 23818293)
  • Report on serum levels of ETAR autoantibodies in peripheral arterial disease (PMID: 24627317)
  • Study suggesting an important role of ETAR in vitiligo based on the positive correlation between ET-1 and ETAR in lesional epidermis (PMID: 23683481)
  • Research on desensitization and internalization of endothelin receptor A and the impact of GRK2-mediated phosphorylation (PMID: 24064210)
  • Study on the presence of ETr-A and ETr-B in rheumatic mitral valves, suggesting interaction with the endothelin system (PMID: 23515723)
  • Research showing that genetic deletion of a nephron-specific endothelin A receptor causes modest fluid retention without altering arterial pressure or sodium excretion (PMID: 23217151)
  • Study observing significantly increased mRNA expression of endothelin A and B receptors and endothelin-1 in failed Fontan patients (PMID: 21356562)
  • Meta-analysis suggesting a significant association between EDNRA -231G>A polymorphism and migraine (PMID: 23058564)
  • Observation of increased myocardial endothelin type A receptor levels in right ventricular hypertrophy compared to non-hypertrophied right ventricles (PMID: 23233754)
  • Study suggesting a potential link between specific genotypes in the ednra gene and susceptibility to pulmonary arterial hypertension (PMID: 21773759)
  • Research showing reduced endothelin A and B receptors, particularly type B, and reduced type B signaling in pulmonary arterial hypertension (PMID: 22688668)
  • Study showing convergence of endothelin A receptor and epidermal growth factor receptor signaling on beta-catenin to promote ovarian cancer metastasis (PMID: 22480520)
  • Observation of predominant ETB receptors in normal human liver and upregulation of liver ETB expression in cirrhosis (PMID: 22365955)
  • Description of the expression of recombinant ET(A) as a fusion protein with phi6 p9 envelope protein and its binding to ET-1 and the alpha subunit of G(q) protein (PMID: 22561246)
  • Identification of SNP, rs6842241, near EDNRA associated with intracranial aneurysm (PMID: 22286173)
  • Study showing that optical imaging with a fluorescent ET(A)R tracer allows noninvasive imaging of tumor-associated ET(A)R expression in vivo (PMID: 22510270)
Database Links

HGNC: 3179

OMIM: 131243

KEGG: hsa:1909

STRING: 9606.ENSP00000315011

UniGene: Hs.183713

Involvement In Disease
Mandibulofacial dysostosis with alopecia (MFDA)
Protein Families
G-protein coupled receptor 1 family, Endothelin receptor subfamily, EDNRA sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and li

Q&A

What is the molecular structure and classification of EDNRA?

EDNRA is a 427 amino acid protein belonging to the rhodopsin-like 7-transmembrane receptor family. The receptor can undergo various post-translational modifications including N-linked glycosylation, phosphorylation, and palmitoylation, which contribute to its functional properties. Human EDNRA shares approximately 86% amino acid identity with mouse and rat EDNRA within the combined extracellular portions of the molecule. This high degree of conservation suggests evolutionary importance of the receptor structure for its biological functions . The receptor specifically binds endothelins ET-1 and ET-2 with higher affinity than ET-3, distinguishing it from the EDNRB subtype which binds all three endothelin isoforms with similar affinity .

What are the primary signaling pathways activated by EDNRA?

EDNRA primarily activates multiple downstream signaling cascades upon binding to its ligands. The receptor functions as a G-protein coupled receptor that triggers the PTK2B, BCAR1, BCAR3, and GTPases RAP1 and RHOA signaling cascades in glomerular mesangial cells . Additionally, ET-1 binding to EDNRA promotes arterial wall remodeling through activation of ROCK (Rho-associated protein kinase) signaling, leading to colocalization of NFATC3 with F-actin filaments . This interaction results in NFATC3 translocation to the nucleus where it promotes transcription of ACTA2, a critical marker for smooth muscle hypertrophy and differentiation. In pulmonary arterial endothelial cells, ET-1 signaling through EDNRA involves the Gi/RhoA/Rho kinase pathway with the participation of transcription factor Sp-1 .

What techniques are commonly used to study EDNRA expression?

Several methodological approaches are employed to investigate EDNRA expression:

  • Quantitative Real-Time PCR (qRT-PCR): This technique allows for precise quantification of EDNRA mRNA levels in various tissues. RNA is typically extracted using the Trizol method, treated with DNase, and reverse-transcribed before amplification with EDNRA-specific primers .

  • Western Blotting: Protein expression of EDNRA can be detected using specific antibodies, such as Human EDNRA Monoclonal Antibody. Expression levels are typically normalized to housekeeping proteins like β-actin .

  • Immunohistochemistry (IHC): IHC permits visualization of EDNRA distribution in tissue sections. For instance, EDNRA has been detected in human kidney sections using specific monoclonal antibodies and HRP-DAB staining systems .

  • Recombination PCR: In conditional knockout studies, this approach allows researchers to verify the recombination of floxed EDNRA alleles in specific tissues or cells .

How can conditional gene targeting be applied to study the temporal specificity of EDNRA function?

Conditional gene targeting represents a sophisticated approach to investigating the timing of EDNRA function during development or in specific physiological contexts. Researchers have employed a conditional mutant mouse strain (Ednra^fl/fl) in combination with tissue-specific Cre recombinase expression systems to achieve temporal control over EDNRA inactivation. For example, Wnt1-Cre and Hand2-Cre driver lines have been used to inactivate EDNRA in neural crest cells at different developmental timepoints .

The methodology involves:

  • Generating mice carrying the conditional Ednra allele (Ednra^fl/fl) along with a tissue-specific Cre expression system.

  • Confirming successful recombination using PCR with primers specific for the recombined allele.

  • Analyzing phenotypic consequences by comparing the conditional knockout with appropriate controls.

This approach has revealed that EDNRA signaling between embryonic days E8.5 and E10.5 is critical for craniofacial development in mice, demonstrating how temporal control of gene inactivation can provide insights into developmental functions .

What approaches can be used to investigate transcriptional regulation of the EDNRA gene?

Transcriptional regulation of EDNRA involves complex mechanisms that can be studied through several methodological approaches:

  • Site-Directed Mutagenesis: This technique allows for targeted modification of potential regulatory elements in the EDNRA promoter region. Specific sites such as progesterone response elements (PREs), GATA2, and AP2 binding sites can be mutated using high-fidelity DNA polymerases and confirmed through restriction enzyme digestion or sequencing .

  • Luciferase Reporter Assays: By linking the EDNRA promoter region to a luciferase reporter gene, researchers can quantitatively assess the activity of the promoter under various conditions or following mutation of specific regulatory elements.

  • Chromatin Immunoprecipitation (ChIP): This technique enables identification of transcription factors that bind to the EDNRA promoter in vivo, providing insights into the regulatory mechanisms controlling its expression.

  • Hormone Response Studies: Evidence indicates that progesterone plays a significant role in regulating EDNRA gene expression both in vivo and in vitro, suggesting the involvement of hormone-responsive elements in transcriptional control .

What are the methodological considerations for studying EDNRA in disease models?

When investigating EDNRA in disease models, particularly in hypertension and vascular disorders, several methodological considerations are important:

  • Inducible Transgenic Models: Systems allowing for temporally controlled endothelial-specific expression of human ET-1 provide valuable tools for studying the long-term effects of ET-1/EDNRA signaling without developmental confounding factors .

  • Pharmacological Interventions: Specific EDNRA antagonists like atrasentan can be employed to distinguish between EDNRA-mediated effects and those involving other pathways. These interventions can reveal whether pathological changes are reversible upon EDNRA blockade .

  • Physiological Measurements: Comprehensive assessment should include blood pressure monitoring, vascular function tests, and evaluation of end-organ damage, particularly renal injury markers.

  • Duration of Study: Long-term studies (e.g., three months) are necessary to observe sustained effects of EDNRA activation on blood pressure and organ systems, as demonstrated in models with endothelial ET-1 overexpression .

How can recombinant EDNRA proteins be optimally used in experimental settings?

Recombinant EDNRA proteins serve as valuable tools in various experimental applications. For optimal utilization:

  • Expression Systems: Select appropriate expression systems based on experimental needs. Wheat germ-based cell-free systems have been successfully used to produce full-length human EDNRA proteins suitable for ELISA and Western blotting applications .

  • Validation: Verify functional activity of recombinant EDNRA through binding assays with labeled endothelin ligands.

  • Storage and Handling: Proper storage conditions (-20 to -70°C) and avoidance of repeated freeze-thaw cycles are critical for maintaining protein integrity and activity .

  • Application-Specific Considerations:

    • For immunological studies: Determine optimal antibody concentrations through titration experiments

    • For binding studies: Consider the influence of post-translational modifications on ligand binding properties

    • For structural studies: Assess protein purity and homogeneity using appropriate analytical techniques

What are the key considerations when designing experiments to investigate EDNRA-mediated cellular responses?

When designing experiments to study EDNRA-mediated cellular responses:

  • Cell Type Selection: Choose cell types that natively express EDNRA or that have been engineered to express controlled levels of the receptor. Human pulmonary arterial endothelial cells (PAECs) and vascular smooth muscle cells are commonly used models .

  • Ligand Concentration and Kinetics: Titrate ET-1 concentrations appropriately, as some responses may not be dose-dependent. For instance, ACVRL-1 upregulation by ET-1 in PAECs does not follow a strict dose-dependency pattern .

  • Pathway Inhibitors: Employ specific inhibitors to delineate signaling pathways:

    • Pertussis toxin (PTX) for Gi protein inhibition

    • Exoenzyme C3 transferase (C3T) for RhoA inhibition

    • Y27632 for Rho kinase inhibition

    • Mithramycin A for Sp-1 inhibition

  • Temporal Considerations: Include appropriate time points for assessing both acute and chronic responses. ACVRL-1 expression changes in response to ET-1 follow specific time courses that should be captured in experimental designs .

What techniques can be employed to study EDNRA receptor-ligand interactions at the molecular level?

Several sophisticated techniques can be employed to investigate EDNRA receptor-ligand interactions:

  • Radioligand Binding Assays: Using radiolabeled endothelins to determine binding affinities, association/dissociation kinetics, and competitive binding profiles.

  • Surface Plasmon Resonance (SPR): This label-free technique allows real-time measurement of binding kinetics between purified EDNRA and various ligands, providing detailed information about association and dissociation rates.

  • FRET/BRET-Based Approaches: Fluorescence or bioluminescence resonance energy transfer techniques can reveal conformational changes in EDNRA upon ligand binding and interactions with downstream signaling molecules.

  • Molecular Docking and Simulation: Computational approaches can predict binding modes and interactions between EDNRA and various ligands, helping to design more selective agonists or antagonists.

  • Mutagenesis Studies: Systematic mutation of amino acids in the receptor binding pocket can identify critical residues for ligand recognition and selectivity between ET-1 and ET-2 versus ET-3.

What are the major challenges in studying EDNRA signaling specificity?

Several significant challenges exist in elucidating EDNRA signaling specificity:

  • Overlapping Signaling Pathways: EDNRA activates multiple downstream pathways, including Gi/RhoA/Rho kinase, making it difficult to isolate specific signaling events responsible for particular physiological outcomes .

  • Cell Type Heterogeneity: EDNRA expression and signaling vary across different cell types and tissues. For instance, EDNRA has distinct roles in vascular smooth muscle cells, neural crest cells, and endothelial cells .

  • Compensatory Mechanisms: Genetic manipulation of EDNRA may trigger compensatory changes in related signaling systems, potentially masking the true physiological role of the receptor.

  • Temporal Dynamics: EDNRA signaling exhibits complex temporal dynamics, with some effects being immediate while others develop over extended periods, requiring careful experimental design to capture the full spectrum of responses .

  • Species Differences: Despite 86% amino acid identity between human and rodent EDNRA in the extracellular domains, species-specific differences in signaling may limit translational relevance of animal models .

How can researchers address contradictions in the literature regarding EDNRA function?

When confronting contradictory findings regarding EDNRA function:

  • Context-Dependent Analysis: Carefully consider experimental contexts, including cell types, developmental stages, and disease models. EDNRA function during embryonic development (E8.5-E10.5) differs substantially from its role in adult vasculature .

  • Methodological Reconciliation: Evaluate methodological differences that might explain contradictory results, such as:

    • Acute versus chronic receptor activation

    • Global versus tissue-specific gene manipulation

    • In vitro versus in vivo studies

    • Pharmacological versus genetic approaches

  • Pathway Cross-Talk Consideration: Investigate potential cross-talk between EDNRA and other signaling pathways that might influence experimental outcomes. For example, interactions between EDNRA signaling and ACVRL-1 expression pathways .

  • Quantitative Analysis: Apply quantitative approaches to reconcile apparently contradictory qualitative observations, recognizing that responses may vary in magnitude rather than direction.

What emerging technologies might advance our understanding of EDNRA biology?

Several cutting-edge technologies hold promise for advancing EDNRA research:

  • Single-Cell Analysis: Single-cell RNA sequencing and proteomics can reveal cell-to-cell variability in EDNRA expression and signaling, potentially uncovering specialized receptor functions in rare cell populations.

  • CRISPR/Cas9 Gene Editing: Precise genetic manipulation allows creation of targeted mutations in endogenous EDNRA, enabling functional studies of specific receptor domains or post-translational modification sites.

  • Optogenetic and Chemogenetic Tools: These approaches permit temporally controlled activation or inhibition of EDNRA signaling in specific cell populations, facilitating the study of acute versus chronic receptor activation.

  • Cryo-EM and Advanced Structural Biology: These techniques may reveal the three-dimensional structure of EDNRA in complex with various ligands and downstream effectors, providing insights into receptor activation mechanisms.

  • Spatial Transcriptomics: This technology can map EDNRA expression patterns with spatial resolution, connecting receptor distribution to local tissue microenvironments and functional specialization.

How does basic EDNRA research inform therapeutic strategies for cardiovascular and renal diseases?

Fundamental research on EDNRA has profound implications for developing therapeutic strategies:

  • Targeted Antagonism: Understanding the molecular details of ET-1 binding to EDNRA has facilitated the development of selective antagonists like atrasentan, which has shown promise in reversing or reducing blood pressure elevation, vascular injury, and early renal injury in experimental models .

  • Pathway-Specific Interventions: Elucidation of downstream signaling pathways has identified potential therapeutic targets beyond the receptor itself. For example, interventions targeting the ROCK signaling pathway might provide alternative approaches to modulating EDNRA-mediated effects on vascular remodeling .

  • Biomarker Development: Research into EDNRA expression patterns and activation has identified potential biomarkers for endothelial dysfunction and vascular injury that could guide therapeutic decision-making and monitoring.

  • Patient Stratification: Basic research suggests that EDNRA antagonists may be particularly beneficial in specific patient populations, such as those with moderate-to-severe or resistant hypertension and renal inflammation .

What methodological approaches can evaluate the efficacy of EDNRA-targeted interventions?

Evaluating EDNRA-targeted interventions requires comprehensive methodological approaches:

  • Translational Models: Inducible endothelial-restricted human ET-1 overexpression models provide valuable platforms for testing EDNRA antagonists without developmental confounding effects .

  • Combinatorial Endpoint Assessment: Effective evaluation requires measuring multiple parameters:

    • Blood pressure monitoring (sustained effects over months)

    • Vascular function and structure (remodeling, compliance)

    • Renal function markers (proteinuria, inflammation)

    • Molecular pathway activation (signaling intermediates)

  • Comparative Pharmacology: Head-to-head comparisons between EDNRA-selective antagonists and dual EDNRA/EDNRB antagonists can reveal the relative contributions of each receptor subtype to therapeutic outcomes.

  • Reversibility Studies: Assessing whether pathological changes can be reversed by EDNRA antagonism after they are established provides crucial information about therapeutic potential in clinical settings where intervention typically begins after disease manifestation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.