Recombinant Human Endothelin B receptor-like protein 2 (GPR37L1)

Shipped with Ice Packs
In Stock

Description

Bacterial Expression

  • Host: E. coli

  • Product: Full-length mature protein (26–481 aa) with >90% purity .

  • Applications: Antibody development, structural studies via SDS-PAGE.

Mammalian Expression

  • Host: HEK293T cells (Multispan Inc.)

  • Tag: N-terminal FLAG tag

  • Functional Assays:

    • Dose-dependent inhibition of forskolin-stimulated cAMP (EC₅₀: ~10 nM) .

    • Ligand-binding studies using prosaptide and maresin 1 (MaR1) .

Signaling Mechanisms and Ligand Interactions

GPR37L1 exhibits constitutive activity and ligand-dependent signaling:

Canonical Pathways

  • Prosaposin/Prosaptide Signaling:

    • Binds prosaposin-derived peptides (e.g., TX14), activating Gαi/o-mediated ERK phosphorylation and cAMP inhibition .

    • Neuroprotective effects in astrocytes via glutamate regulation .

  • Maresin 1 (MaR1) Interaction:

    • MaR1 binds GPR37L1 (K<sub>d</sub> ~50 nM), potentiating KCNJ10/KCNJ3 potassium channels in satellite glial cells .

    • Molecular docking shows stable hydrogen bonding in the EDNRB-like binding pocket .

Constitutive Activity

  • Metalloprotease cleavage of the N-terminus reduces basal Gαs signaling, suggesting autoregulation .

Research Applications

ApplicationKey FindingsReference
Neurological DisordersGPR37L1 knockdown exacerbates neuropathic pain; MaR1 rescues K<sup>+</sup> channel dysfunction .
Cardiovascular BiologyRegulates blood pressure via central mechanisms; deletion causes hypertension in mice .
CancerModulates glioblastoma cell proliferation via Shh pathway .

Clinical and Therapeutic Implications

  • Neuroprotection: Recombinant GPR37L1 agonists (e.g., MaR1) attenuate chemotherapy-induced neuropathy .

  • Epilepsy: The GPR37L1-E296K variant impairs receptor stability, increasing seizure susceptibility .

  • Hypertension: Central GPR37L1 modulation presents a target for blood pressure management .

Challenges and Future Directions

  • Ligand Validation: Prosaposin and MaR1 binding mechanisms require crystallographic confirmation .

  • Disease Models: GPR37L1<sup>-/-</sup> mice show cerebellar dysplasia and hypertension, necessitating humanized models .

  • Drug Development: High-throughput screens for small-molecule modulators are ongoing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its development.
Synonyms
GPR37L1; ETBRLP2; G-protein coupled receptor 37-like 1; Endothelin B receptor-like protein 2; ETBR-LP-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-481
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
APLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVAT SPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSAYAIMLLALVVFAVGI VGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVLFFCLPIVIFNEITKQRLLGDVSCRA VPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVRPIERCQSILAKLAVIWVGSMTLAVP ELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYSLVMTYQNARMWWYFGCYFCLPILFT VTCQLVTWRVRGPPGRKSECRASKHEQCESQLNSTVVGLTVVYAFCTLPENVCNIVVAYL STELTRQTLDLLGLINQFSTFFKGAITPVLLLCICRPLGQAFLDCCCCCCCEECGGASEA SAANGSDNKLKTEVSSSIYFHKPRESPPLLPLGTPC
Uniprot No.

Target Background

Function
GPR37L1 is a G-protein coupled receptor that has been shown to bind the neuroprotective and glioprotective factor prosaposin (PSAP), triggering endocytosis and an ERK phosphorylation cascade. However, other studies suggest that prosaposin might not enhance activity. It has been proposed that GPR37L1 is a constitutively active receptor that signals through the guanine nucleotide-binding protein G(s) subunit alpha. GPR37L1 plays a role in regulating postnatal cerebellar development by modulating the Shh pathway. It also regulates baseline blood pressure in females and offers protection against cardiovascular stress in males. GPR37L1 mediates inhibition of astrocyte glutamate transporters and reduction in neuronal N-methyl-D-aspartate receptor activity.
Gene References Into Functions
  1. These findings link GPR37L1 and GPR37 to seizure etiology and demonstrate an association between a homozygous variant in GPR37L1 (c.1047G>T [Lys349Asn]) and a novel progressive myoclonus epilepsy. PMID: 28688853
  2. Data reveals that G protein (heterotrimeric guanine nucleotide-binding protein)-coupled receptor (GPR37L1) couples to the G protein Galpha(s) when heterologously expressed in cultured cells. PMID: 27072655
  3. GPR37 and GPR37L1 are receptors for the neuroprotective and glioprotective factors prosaptide and prosaposin. PMID: 23690594
Database Links

HGNC: 14923

OMIM: 617630

KEGG: hsa:9283

STRING: 9606.ENSP00000356251

UniGene: Hs.132049

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, cilium membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in primary cortical astrocytes (at protein level). Expressed in the central nervous system.

Q&A

Where is GPR37L1 predominantly expressed?

GPR37L1 exhibits a remarkable tissue-specific expression pattern that is crucial for understanding its physiological functions. The receptor is highly expressed in the central nervous system, particularly in glial cells. Studies have demonstrated that GPR37L1 is predominantly found in:

  • Astrocytes and microglia in the brain

  • Bergmann glia astrocytes in the cerebellum, particularly during postnatal development

  • Satellite glial cells (SGCs) in dorsal root ganglia (DRGs)

Notably, recent research has revealed that "Gpr37l1/GRP37L1 ranks among the most highly expressed GPCR transcripts in mouse and human dorsal root ganglia (DRGs) and is selectively expressed in satellite glial cells (SGCs)" . This specific expression pattern suggests a specialized role in neuronal-glial communication and modulation of neuronal activity.

What are the known ligands for GPR37L1?

  • Maresin 1 (MaR1): A proresolving lipid mediator that has been identified as a ligand for GPR37L1. Research demonstrates that "maresin 1 (MaR1) serves as a ligand of GPR37L1 and enhances KCNJ10- or KCNJ3-mediated potassium influx in SGCs through GPR37L1" .

  • Prosaptide (TX14(A)): This peptide has been shown to function as an agonist for GPR37L1, with studies revealing that "receptor variants exhibited varying abilities to reduce cAMP levels, activate mitogen-activated protein kinase (MAPK) signaling, and/or upregulate receptor expression in response to the agonist prosaptide (TX14(A))" .

The identification of these ligands has been crucial for characterizing the receptor's signaling mechanisms and physiological roles.

What are the most effective methods to detect and quantify GPR37L1 expression?

Detection and quantification of GPR37L1 require careful consideration of antibody selection and methodological approach. Research has revealed significant challenges in GPR37L1 detection:

  • Western Blot Analysis: When working with GPR37L1, antibody validation is critical. As demonstrated in research with the related endothelin B receptor (ETB), "antibodies targeted to the N or C terminal (NT or CT, respectively) and the second or third intracellular loop (IL2 or IL3, respectively)" may have dramatically different specificities . Researchers should be aware that GPR37L1 may be detected at different molecular weights (e.g., full-length vs. processed forms) depending on the antibody used and cell type studied.

  • Immunohistochemistry/Immunofluorescence: For tissue localization studies, antibodies targeting different epitopes may yield varying results. Always validate antibodies using positive and negative controls such as transfected cells and knockout tissues.

  • qRT-PCR: For mRNA expression analysis, this remains a reliable method to quantify GPR37L1 transcript levels across different tissues or experimental conditions.

  • Reporter Systems: In experimental settings, fusion of GPR37L1 with fluorescent proteins can facilitate visualization of receptor trafficking and localization.

Given the challenges with antibody specificity, it is recommended that researchers employ multiple detection methods to confirm GPR37L1 expression patterns.

How can GPR37L1 knockout models be generated and validated?

Several successful approaches to generating GPR37L1 knockout models have been documented in the literature:

  • Targeted Gene Deletion: "A KO mouse line lacking Gpr37l1 was generated" to study the receptor's role in migraine and related disorders . This approach typically involves homologous recombination or CRISPR-Cas9 techniques to disrupt the gene.

  • Cell Line Knockouts: For in vitro studies, "KO of GPR37L1 or expression of certain rare variants altered cellular cholesterol levels" . CRISPR-Cas9 technology can be used to create stable knockout cell lines.

Validation of knockout models should include:

  • Genotyping: Confirming the genetic deletion using PCR

  • Transcript Analysis: Verifying absence of GPR37L1 mRNA using qRT-PCR

  • Protein Expression: Confirming lack of protein expression through Western blot or immunostaining

  • Functional Assays: Demonstrating altered physiological responses consistent with GPR37L1 absence

Researchers should also be aware of potential compensatory mechanisms in knockout models, as related receptors might be upregulated in response to GPR37L1 deletion.

What cell lines are most suitable for studying GPR37L1 function?

Based on the research literature, several cell systems have proven effective for GPR37L1 studies:

Cell TypeAdvantagesApplicationsReference
SK-N-MC cellsHuman neuroblastoma line expressing relevant neuronal markersSignaling studies, variant analysis
Primary astrocytesEndogenous expression of GPR37L1Native signaling, physiological relevance
HEK293 cellsEasily transfectable, low backgroundRecombinant expression, trafficking studies
Primary satellite glial cellsNatural expression contextPain signaling, potassium channel regulation

For recombinant expression, wheat germ expression systems have been used successfully for producing related receptors . When selecting a cell system, researchers should consider whether native or overexpressed receptors are more appropriate for their specific research questions.

How are GPR37L1 variants associated with neurological disorders?

GPR37L1 variants have been significantly associated with several neurological conditions through comprehensive genetic and functional studies:

  • Migraine: "Rare GPR37L1 coding variants were binned according to predicted pathogenicity and analyzed by sequence kernel association testing to reveal significant associations with disease diagnostic codes for epilepsy and migraine, among others" . The association with migraine was further validated through functional characterization of these variants.

  • Epilepsy: GPR37L1 has been "significantly associated with generalized epilepsy" and "a point mutation in GPR37L1 has previously been found in a consanguineous family with a progressive form of myoclonus epilepsy" .

  • Anxiety-Related Disorders: "KO animals did not recapitulate an acute migraine phenotype, the loss of this receptor produced sex-specific changes in anxiety-related disorders often seen in chronic migraineurs" .

  • Chronic Pain: "Genetic analysis revealed that the GPR37L1-E296K variant increased chronic pain risk by destabilizing the protein and impairing the protein's function" .

These findings highlight the potential importance of GPR37L1 in neuropsychiatric pathophysiology, with genetic variations potentially contributing to disease susceptibility through altered signaling capabilities.

What is the role of GPR37L1 in cerebellar development?

GPR37L1 plays a crucial role in cerebellar development, particularly during postnatal stages:

  • Regulation of Proliferation and Maturation: "The ablation of the murine Gpr37l1 gene results in premature down-regulation of proliferation of granule neuron precursors and precocious maturation of Bergmann glia and Purkinje neurons" .

  • Sonic Hedgehog (Shh) Pathway Modulation: "In the developing cerebellum, the proliferation and differentiation of glial and neuronal cell types depend on the modulation of the sonic hedgehog (Shh) signaling pathway" . GPR37L1 has been shown to interact with this pathway, as "the patched 1–associated Gpr37l1 receptor participates in the regulation of postnatal cerebellum development" .

  • Motor Function Impact: Interestingly, these developmental alterations result in "improved adult motor learning and coordination" , suggesting that GPR37L1 may act as a developmental timing regulator.

  • Cellular Localization: In Bergmann glia cells, "Gpr37l1 is associated with primary cilium membranes and it specifically interacts and colocalizes with the Shh primary receptor, patched 1" .

These findings highlight the importance of GPR37L1 in coordinating the precise timing of cerebellar development through its interaction with key developmental signaling pathways.

How does GPR37L1 contribute to pain processing and neuropathic pain?

Recent research has uncovered significant roles for GPR37L1 in pain processing, particularly in the context of neuropathic pain:

  • Expression in Pain Processing Circuits: GPR37L1 is "selectively expressed in satellite glial cells (SGCs)" of dorsal root ganglia, which are critical for pain signal processing .

  • Modulation of Potassium Channels: "GPR37L1 is coexpressed with potassium channels, including KCNJ10 (Kir4.1) in mouse SGCs and both KCNJ3 (Kir3.1) and KCNJ10 in human SGCs" and "regulates the surface expression and function of the potassium channels" . This regulation of potassium channels is crucial for controlling neuronal excitability.

  • Response to Neuropathic Conditions: "Peripheral neuropathy induced by streptozotocin (STZ) and paclitaxel (PTX) led to reduced GPR37L1 expression on the plasma membrane in mouse and human DRGs" , suggesting alterations in GPR37L1 function during neuropathic conditions.

  • Pain Resolution: "Transgenic mice with Gpr37l1 deficiency exhibited impaired resolution of neuropathic pain symptoms following PTX- and STZ-induced pain, whereas overexpression of Gpr37l1 in mouse DRGs reversed pain" .

These findings collectively position GPR37L1 as a potential therapeutic target for neuropathic pain conditions, particularly through its regulation of potassium channels in satellite glial cells.

What signaling pathways are regulated by GPR37L1?

GPR37L1 engages multiple signaling pathways that contribute to its diverse physiological functions:

  • cAMP Regulation: GPR37L1 can "reduce cAMP levels" in response to agonist stimulation , suggesting coupling to Gαi/o proteins that inhibit adenylyl cyclase.

  • MAPK Pathway Activation: The receptor can "activate mitogen-activated protein kinase (MAPK) signaling" upon stimulation with agonists like prosaptide (TX14(A)) .

  • Cholesterol Regulation: "KO of GPR37L1 or expression of certain rare variants altered cellular cholesterol levels, which were also acutely regulated by administration of the agonist TX14(A) via activation of the MAPK pathway" . This links GPR37L1 signaling to cellular lipid homeostasis.

  • Potassium Channel Modulation: As noted earlier, GPR37L1 "regulates the surface expression and function of the potassium channels" in glial cells , which affects neuronal activity.

  • Sonic Hedgehog Pathway: In cerebellar development, GPR37L1 interacts with the Shh pathway, specifically through association with "the Shh primary receptor, patched 1" .

These diverse signaling mechanisms highlight the complex and context-dependent functions of GPR37L1 in different cellular environments.

How does the maresin 1-GPR37L1 axis function in neuroprotection?

The maresin 1-GPR37L1 signaling axis represents an important mechanism in neuroprotection and pain resolution:

  • Maresin 1 as an Endogenous Ligand: "The proresolving lipid mediator maresin 1 (MaR1) serves as a ligand of GPR37L1" , establishing a functional ligand-receptor relationship.

  • Potassium Channel Regulation: "MaR1 enhances KCNJ10- or KCNJ3-mediated potassium influx in SGCs through GPR37L1" . This regulation of potassium channels is critical for maintaining proper neuronal excitability.

  • Rescue Effects in Neuropathy: "Chemotherapy suppressed KCNJ10 expression and function in SGCs, which MaR1 rescued through GPR37L1" . This demonstrates the therapeutic potential of targeting this signaling axis in neuropathic conditions.

  • Neuroprotective Function: The ability of this signaling pathway to regulate potassium channels and potentially resolve neuroinflammation suggests a broader neuroprotective role that could be exploited therapeutically.

These findings position the maresin 1-GPR37L1 axis as a promising target for developing treatments for neuropathic conditions, potentially offering a novel approach to addressing chronic pain.

What are the sex-specific effects of GPR37L1 modulation and their implications?

A particularly intriguing aspect of GPR37L1 research is the emerging evidence for sex-specific effects:

  • Behavioral Differences: "Loss of this receptor produced sex-specific changes in anxiety-related disorders often seen in chronic migraineurs" . This suggests that GPR37L1 may function differently in males versus females.

  • Migraine Relevance: Given that migraine has higher prevalence in females, these sex-specific effects may have significant implications for understanding migraine pathophysiology and developing targeted treatments.

  • Cerebellar Development: While not explicitly stated in the search results, the role of GPR37L1 in cerebellar development may also exhibit sex differences that could impact motor learning and coordination.

  • Experimental Design Implications: These findings highlight the importance of including both sexes in experimental designs and analyzing data for potential sex-specific effects when studying GPR37L1.

Understanding these sex-specific effects could be critical for developing personalized therapeutic approaches targeting GPR37L1 in various neurological disorders.

How can rare GPR37L1 variants be functionally characterized?

Functional characterization of rare GPR37L1 variants requires systematic approaches:

  • Computational Prediction and Association: "Rare GPR37L1 coding variants were binned according to predicted pathogenicity and analyzed by sequence kernel association testing to reveal significant associations with disease diagnostic codes" . This approach provides initial evidence for variant pathogenicity.

  • Expression Analysis: Evaluating how variants affect receptor expression levels and cellular localization, as some variants may "upregulate receptor expression in response to the agonist" .

  • Signaling Pathway Assessment: Testing variant effects on multiple downstream pathways, as "receptor variants exhibited varying abilities to reduce cAMP levels, activate mitogen-activated protein kinase (MAPK) signaling" .

  • Cellular Function Evaluation: Examining how variants impact specific cellular functions, such as "cholesterol levels, which were also acutely regulated by administration of the agonist TX14(A) via activation of the MAPK pathway" .

  • Animal Models: For particularly interesting variants, generating knock-in animal models can provide insights into physiological and behavioral consequences, as demonstrated with the complete knockout approach .

This multifaceted approach to variant characterization can help establish causality between genetic variations and disease phenotypes, potentially leading to personalized therapeutic strategies.

What are the most promising therapeutic directions for targeting GPR37L1?

Based on current research, several therapeutic directions for targeting GPR37L1 show promise:

  • Pain Management: "GPR37L1 in SGCs offers a therapeutic target for the protection of neuropathy and chronic pain" . This could involve developing agonists that enhance GPR37L1 function in satellite glial cells.

  • Migraine Treatment: Given the association between GPR37L1 variants and migraine, modulating GPR37L1 function could offer novel approaches to treating migraine, particularly in patients with specific genetic variants .

  • Neuroprotective Strategies: The role of GPR37L1 in neuroprotection suggests that enhancing its function could be beneficial in neurodegenerative conditions or after neural injury.

  • Maresin 1 Mimetics: Developing synthetic analogues of maresin 1 that target GPR37L1 could provide new therapeutic options for neurological disorders with fewer side effects than current treatments .

  • Potassium Channel Modulation: Since GPR37L1 regulates potassium channels, targeting this mechanism could provide an indirect approach to modulating neuronal excitability in conditions like epilepsy .

These therapeutic directions highlight the potential clinical significance of GPR37L1 research and underscore the importance of continuing to investigate this receptor's biology and pharmacology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.