Recombinant Human Ephrin-B1 (EFNB1)

Shipped with Ice Packs
In Stock

Description

Domain Organization

FeatureDescription
Extracellular DomainBinds EphB receptors (e.g., EphB1–B4) and EphA4 .
Transmembrane DomainAnchors the protein to the cell membrane .
Cytoplasmic DomainFacilitates reverse signaling through PDZ-binding motifs .

Glycosylation

  • N-glycosylation: Occurs at asparagine residues (e.g., N139) and modulates ligand-receptor interactions, drug sensitivity, and immune signaling .

  • Functional Impact: Glycosylation-deficient mutants exhibit altered transcriptional regulation and reduced chemotherapeutic sensitivity in tumor models .

Production and Recombinant Formats

Recombinant EFNB1 is typically expressed in mammalian systems (e.g., HEK293 cells) to ensure proper post-translational modifications . Common variants include:

Common Constructs

ConstructTag(s)ApplicationsSource
EFNB1-RBD-Fc ChimeraC-terminal FcReceptor binding assays, therapeutic studies
Full-Length EFNB1His or Myc/DDKCell migration studies, structural analysis

Biochemical Properties

ParameterSpecification
Purity>95% (SDS-PAGE)
Endotoxin Levels<1.0 EU/µg (LAL assay)
ActivityValidated via EphB3 binding (EC₅₀: 1.56–25 ng/mL)

3.1. Developmental and Neurological Functions

  • Axon Guidance: Mediates repulsive cues during neural crest cell migration .

  • Skeletal Morphogenesis: Required for segmental boundary formation; mutations cause craniofrontonasal syndrome (CFNS) .

  • Germinal Center B Cells: Marks mature B cells in germinal centers, influencing antibody affinity maturation .

3.2. Cancer and Therapeutic Potential

  • Tumor Microregulation: EFNB1-RBD-Fc inhibits B-lymphoma proliferation and modulates stromal cell activity .

  • Drug Resistance: Glycosylation status impacts chemotherapy response (e.g., reduced sensitivity in N139D mutants) .

3.3. Immune Regulation

  • Monocyte Migration: EphB2-Ephrin-B1 signaling drives chemotaxis in atherosclerosis models .

  • Osteoclast Differentiation: Regulates bone resorption via EphB receptor crosstalk .

4.1. Current Applications

ApplicationMechanismReference
Cancer TherapyAgonist/antagonist of Eph-Ephrin signaling
Bone DisordersTargeting osteoclast differentiation pathways

4.2. Challenges

  • Glycosylation Variability: Impacts efficacy in Fc fusion proteins .

  • Cis- vs. Trans-Signaling: Context-dependent effects complicate therapeutic targeting .

Table 1: Glycosylated vs. Non-Glycosylated EFNB1-RBD-Fc

ParameterGlycosylated EFNB1Non-Glycosylated EFNB1
Drug SensitivityEnhanced chemoresistanceReduced chemoresistance
Immune ModulationActivates oxidative phosphorylationSuppresses immune pathways
Stromal InteractionInhibits fibroblast activationVariable effects
Data derived from transcriptomic and co-culture studies .

Future Directions

  • Glycoengineering: Optimizing glycosylation patterns for improved therapeutic specificity .

  • Dual Targeting: Combining EFNB1 agonists with checkpoint inhibitors in cancer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development according to your specifications.
Synonyms
EFNB1; EFL3; EPLG2; LERK2; Ephrin-B1; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-346
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
EFNB1
Target Protein Sequence
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Uniprot No.

Target Background

Function
Ephrin-B1 serves as a cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases that play a crucial role in cell migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Binding to Eph receptors on adjacent cells initiates contact-dependent bidirectional signaling between neighboring cells. Ephrin-B1 exhibits high affinity for the receptor tyrosine kinase EPHB1/ELK. It can also bind EPHB2 and EPHB3. Ephrin-B1 interacts with and induces collapse of commissural axons/growth cones in vitro. This suggests a potential role in regulating the orientation of longitudinally projecting axons.
Gene References Into Functions
  1. Lymphomas with low UTX expression exhibit high levels of Efnb1, which correlates with significantly poor survival. PMID: 30006524
  2. Chronic hypoxia-induced slug promotes invasive behavior of prostate cancer cells by activating the expression of ephrin-B1. PMID: 30058095
  3. This study demonstrated that EphB2 cells experience a transient increase in migration following heterotypic activation, which underlies a shift in the EphB2-ephrinB1 border but is not essential for segregation or border sharpening. PMID: 28747399
  4. Expression of EFNB1 and EFNB2 is implicated in Th cell differentiation and migration to inflammatory sites in both EAE and MS PMID: 27039370
  5. This research demonstrates that mosaicism for EPHRIN-B1 expression induced by random X inactivation in heterozygous females results in robust cell segregation in human neuroepithelial cells. This provides experimental evidence that Eph/ephrin-mediated cell segregation is relevant to the pathogenesis in human CFNS patients. PMID: 28238796
  6. One novel (IVS2+3G>T) and one previously reported mutation (p.Gly151Ser) in EFNB1 were identified. Both patients were de novo cases without a family history of Craniofrontonasal syndrome. PMID: 27650623
  7. While ephrin-B1 deficiency leads to abnormal visual pathways in mice, the human visual system, except for deficits in binocular vision, remains largely normal. PMID: 26580852
  8. This study found that EFNB1 co-localizes with microtubules (MTs) during all phases of the cell cycle. PMID: 25436983
  9. This report describes a family with a G151S mutation in the EFNB1 gene. The mutation was identified in two severely affected sisters and paradoxically in their clinically unaffected father. PMID: 25486017
  10. T cells from rheumatoid arthritis (RA) patients expressed higher EFNB1 mRNA levels, which correlated with RA symptoms and laboratory findings. Expression of EFNB1 in T cells might be a parameter for monitoring RA disease activity and treatment responses. PMID: 25779027
  11. Results suggest that EphrinB1 is uniquely dysregulated in medulloblastoma and promotes oncogenic responses in medulloblastoma cells, implicating ephrinB1 as a potential therapeutic target. PMID: 25258252
  12. EphB2/ephrin-B1 were involved in dental pulp stem cells with TNF-alpha treatment via the JNK-dependent pathway, but not NF-kB, p38 MAPK or MEK signaling. PMID: 25643922
  13. Patients with EFNB1 mutations exhibit a clear phenotype. This study will facilitate genetic counseling for parents and patients, and contribute to the diagnostic and screening process for individuals with suspected CFNS. PMID: 24281372
  14. CNK1 mediates ephrinB1 signaling that promotes cell migration through RhoA and JNK activity. PMID: 24825906
  15. EphrinB1 expression is linked to breast cancer metastasis, and its enhanced expression is associated with a poor prognosis, suggesting that EphrinB1 could be a relevant therapeutic target in breast cancers. PMID: 24240587
  16. High EFNB1 expression is associated with squamous cell carcinomas of the head and neck. PMID: 23811940
  17. This report identifies mosaic EFNB1 mutations in every individual with craniofrontonasal syndrome, confirming the suggested diagnosis and supporting the hypothesis of cellular interference in humans. PMID: 23335590
  18. Data suggest that Nm23-H1 regulates contact inhibition of locomotion, and its negative regulation by ephrin-B1. PMID: 22718351
  19. Data show that EphrinB1, a PTPN13 substrate, interacts with ErbB2, and Src kinase mediates EphrinB1 phosphorylation and subsequent MAP Kinase signaling. PMID: 22279592
  20. X-linked cases resembling Teebi hypertelorism may have a similar mechanism to CFNS, and that cellular mosaicism for different levels of ephrin-B1 (as well as simple presence/absence) leads to craniofacial abnormalities. PMID: 21542058
  21. An unreported mutation in EFNB1 predicts the occurrence of congenital diaphragmatic hernia, with phenotypic differences observed between males and females. PMID: 20734337
  22. This study reports the impact of craniofrontonasal syndrome-causing EFNB1 mutations on ephrin-B1 function. PMID: 20565770
  23. This study reports that the expression of ephrin-B1 is controlled by a feedback loop involving posttranscriptional regulatory mechanisms. PMID: 20308325
  24. A combination of SDF-1, PTN, IGF2, and EFNB1 mimics the DA phenotype-inducing property of SDIA and was sufficient to promote differentiation of hESC to functional midbrain DA neurons. PMID: 19672298
  25. Human platelets express EphA4 and EphB1, and the ligand, ephrinB1. Forced clustering of EphA4 or ephrinB1 led to cytoskeletal reorganization, adhesion to fibrinogen, and alpha-granule secretion. PMID: 12084815
  26. This study examined the expression profile of this ligand of EPHB2 in gastric cancer. PMID: 12136247
  27. The expression of ephrin-B1 was correlated with a poorer clinical prognosis. Ephrin-B1 protein was expressed by osteosarcoma cells and blood vessels. PMID: 12209731
  28. This research identified a novel interaction between EphB1 with the adaptor molecule Grb7 and suggested that this interaction may play a role in the regulation of cell migration by EphB1. PMID: 12223469
  29. This study examined the expression of Eph-B1 in plasmacytoid dendritic cells. PMID: 12384430
  30. Ephrin B1 induces human aortic endothelial cells migration through a pathway involving Crk adaptor protein. PMID: 12475948
  31. This research concludes that ephrinB1 and B class Eph receptors provide positional cues necessary for the normal morphogenesis of skeletal elements. PMID: 12919674
  32. Eph/ephrin signaling enhances the ability of platelet agonists to cause aggregation by activating Rap1. These effects require oligomerization of ephrinB1 but not phosphotyrosine-based interactions with the ephrinB1 cytoplasmic domain. PMID: 14576067
  33. Ephrin-B1 may be involved in in vivo tumor progression by promoting neovascularization in hepatocellular carcinoma. PMID: 14642617
  34. Mutations of the ephrin-B1 gene cause craniofrontonasal syndrome. PMID: 15124102
  35. Ephrin-B1 internalization is an active receptor-mediated process that utilizes the clathrin-mediated endocytic pathway. PMID: 15351694
  36. Upon ephrinB1 stimulation, the small GTPases Rho and Ras are activated, while Rap1 is inactivated. PMID: 15725075
  37. EFNB1 mutations have a role in familial and sporadic craniofrontonasal syndrome (CFNS). PMID: 15959873
  38. EphB/ephrin-B molecules play a role in restricting dental pulp stem cell attachment and migration, maintaining these cells within their stem cell niche under steady-state conditions. PMID: 17204606
  39. The C-terminus of ephrin-B1 regulates the activation of extracellular release of MMP-8 without requiring de novo protein synthesis. PMID: 17567680
  40. Results suggest that tyrosine phosphorylation of ephrin-B1 promotes invasion of cancer cells in vivo. PMID: 17591954
  41. Silencing of EphB expression is associated with colorectal tumorigenesis. PMID: 17906625
  42. EphrinB1 might play a significant role in the inflammatory states of rheumatoid arthritis by affecting the population/function of T cells. PMID: 17942634
  43. EFNB1 mutant transcripts with nonsense codons are degraded by the nonsense-mediated mRNA decay pathway and lead to craniofrontonasal syndrome. PMID: 18043713
  44. Ephrin-B1 is likely to play a critical role in the regulation of malignant T lymphocytes through the control of lipid-raft-associated signaling, adhesion, and invasive activity. PMID: 18314490
  45. Several new EFNB1 mutations have been identified in craniofrontonasal syndrome. PMID: 18627045

Show More

Hide All

Database Links

HGNC: 3226

OMIM: 300035

KEGG: hsa:1947

STRING: 9606.ENSP00000204961

UniGene: Hs.144700

Involvement In Disease
Craniofrontonasal syndrome (CFNS)
Protein Families
Ephrin family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.; [Ephrin-B1 C-terminal fragment]: Cell membrane; Single-pass type I membrane protein.; [Ephrin-B1 intracellular domain]: Nucleus.
Tissue Specificity
Widely expressed. Detected in both neuronal and non-neuronal tissues. Seems to have particularly strong expression in retina, sciatic nerve, heart and spinal cord.

Q&A

What is the basic structure of human Ephrin-B1 protein?

Human Ephrin-B1 is a transmembrane protein belonging to the ephrin family. The mature protein consists of a 210 amino acid extracellular domain (ECD), a 21 amino acid transmembrane segment, and an 88 amino acid cytoplasmic domain. The protein encoded by the EFNB1 gene on the X chromosome has a molecular weight of approximately 45 kDa. The ECD is structurally related to GPI-anchored Ephrin-A ligands, while the cytoplasmic domain contains six tyrosine residues that can be phosphorylated and a PDZ-binding motif at the C-terminus that facilitates interaction with PDZ domain-containing proteins .

How does Ephrin-B1 signaling differ from other ephrin family members?

Ephrin-B1 engages in bidirectional signaling mechanisms that distinguish it from other family members. While all ephrins can initiate forward signaling through Eph receptors, Ephrin-B1 has unique reverse signaling capabilities through both PDZ-dependent and phosphorylation-dependent pathways. Unlike Ephrin-A ligands which are GPI-anchored, Ephrin-B1's transmembrane domain enables it to transduce signals into the cells expressing it. Experimental evidence has demonstrated that disruption of PDZ-dependent reverse signaling (through mutation of the PDZ-binding motif) while maintaining phosphorylation-dependent signaling is sufficient to cause corpus callosum agenesis, indicating functional specificity of these pathways . This signaling specificity helps explain why Ephrin-B1 mutations result in distinct developmental phenotypes compared to other ephrin family members.

What are the primary binding partners of Ephrin-B1 and how can binding affinity be experimentally measured?

Ephrin-B1 preferentially interacts with receptors in the EphB family, though with differential affinities. Key binding partners include:

Binding PartnerInteraction TypeFunctional Significance
EphB2Trans-synapticAxon guidance, presynaptic development
EphB3Trans-synapticMeasured in functional ELISA with linear range 1.56-25 ng/ml
Syntenin-1PDZ-dependentPresynaptic organization via ERC2/CAST1
Claudin-1, -4, -5Cis-interactionLateral membrane stabilization, cardiac function

Researchers can quantify these interactions using several methodologies: GST pull-down assays, yeast two-hybrid screening, X-ray crystallography, and functional ELISA. For instance, immobilized mouse EphB3 at 2 μg/ml can bind human EFNB1 Fc chimera with a linear binding range of 1.56-25 ng/ml, providing a standardized approach to measure interaction strength . For investigating the specificity of interactions, mutagenesis of the PDZ-binding domain combined with co-immunoprecipitation assays can determine which interactions depend on specific protein domains .

Where is Ephrin-B1 primarily expressed in human tissues?

Ephrin-B1 demonstrates tissue-specific expression patterns that correlate with its diverse developmental and physiological functions. Major sites of expression include:

  • Nervous system: Axons of the corpus callosum, neural crest cells, reactive astrocytes

  • Immune system: Developing thymocytes, peripheral T cells, monocytes, macrophages

  • Cardiovascular system: Vascular endothelial cells, cardiomyocytes, atherosclerotic plaques

  • Skeletal system: Osteoclasts

  • Reproductive system: Luteinizing granulosa cells in the ovary

  • Other tissues: Glomerular podocyte slit diaphragms

These expression patterns are typically detected through immunohistochemistry, RT-PCR, and Western blot analysis, with differential expression observed during development and in disease states . Within specific tissues, subcellular localization can be determined using immunofluorescence with confocal microscopy.

How does X-inactivation affect Ephrin-B1 expression in heterozygous females with EFNB1 mutations?

In heterozygous females with EFNB1 mutations, random X-inactivation creates a cellular mosaic where some cells express wild-type Ephrin-B1 while others express mutant versions (or no Ephrin-B1 in case of null mutations). This mosaicism leads to an interesting phenomenon called "cellular interference," where the juxtaposition of cells with different Ephrin-B1 expression levels creates abnormal boundary formation and altered cell sorting that contributes to more severe phenotypes in females than hemizygous males.

Experimental evidence supporting this concept has been demonstrated through clonal expansion of patient cells with either the wild-type or mutant EFNB1 on the active X-chromosome. These studies have successfully separated mutant and wild-type EFNB1-expressing cells in vitro, confirming the cellular interference hypothesis . Additionally, mouse models with targeted EFNB1 mutations show that allelic imbalance results in aberrant cell mixing of cranial primordia during development . This phenomenon explains the paradoxical inheritance pattern of craniofrontonasal syndrome (CFNS) where heterozygous females are more severely affected than hemizygous males.

What post-translational modifications regulate Ephrin-B1 function and how can they be detected?

Ephrin-B1 undergoes several critical post-translational modifications that regulate its function:

  • Tyrosine phosphorylation: Upon EphB receptor binding, the six intracellular tyrosines of Ephrin-B1 can be phosphorylated, enabling phosphorylation-dependent reverse signaling. Detection method: Immunoprecipitation with anti-Ephrin-B1 antibody followed by immunoblotting with anti-phosphotyrosine antibodies. A characteristic band shift can be observed in immunoblots of E13.5 embryonic head lysates .

  • Proteolytic processing: Ligation by EphB2 enhances shedding of a 35 kDa fragment of the Ephrin-B1 ECD. The remaining membrane-bound portion is then cleaved by gamma-secretase to release the intracellular domain. Detection method: Western blotting using domain-specific antibodies to track fragment sizes .

  • PDZ-binding domain interactions: The C-terminal YKV motif interacts with PDZ domain-containing proteins like syntenin-1. Detection method: GST pull-down assays, yeast two-hybrid screening, or co-immunoprecipitation with antibodies against potential binding partners .

To analyze these modifications in depth, researchers can employ site-directed mutagenesis to generate phosphorylation-deficient mutants (e.g., the 6F mutant where all tyrosines are replaced with phenylalanine) or PDZ-binding deficient mutants (ΔV) to investigate the specific contribution of each modification pathway to Ephrin-B1 function .

What developmental processes depend on Ephrin-B1 signaling?

Ephrin-B1 coordinates multiple critical developmental processes across various organ systems:

  • Nervous system development: Axon guidance, corpus callosum formation, neural crest cell migration

  • Craniofacial development: Formation of facial structures and prevention of craniofrontonasal abnormalities

  • Skeletal morphogenesis: Proper skeletal element formation and prevention of polydactyly

  • Cardiovascular development: Cardiac muscle morphogenesis and angiogenic capillary plexi formation

  • Immune system development: Thymocyte survival and maturation

Research has revealed that PDZ-dependent reverse signaling by Ephrin-B1 is particularly crucial for corpus callosum formation, while being dispensable for craniofacial and skeletal development. This was demonstrated through targeted mutations in mouse models that selectively disrupt specific signaling pathways while maintaining others . These findings illustrate how different Ephrin-B1 signaling mechanisms may be selectively required for specific developmental processes.

How do mutations in the EFNB1 gene cause craniofrontonasal syndrome (CFNS)?

Craniofrontonasal syndrome (CFNS) is caused by mutations in the EFNB1 gene and exhibits a paradoxical inheritance pattern where heterozygous females are more severely affected than hemizygous males. This phenomenon is explained by the following mechanisms:

  • Nonsense-mediated decay (NMD): Over 50% of EFNB1 mutations result in premature termination codons that trigger mRNA degradation through NMD. Studies using RT-PCR in fibroblast cultures from CFNS patients revealed differential degradation of mutant transcripts. For example, severe depletion of transcripts was observed with splice site mutation c.407-2A>T and frameshift mutation c.377_384delTCAAGAAG, while mutation c.614_615delCT near the 3'-end of the penultimate exon escaped NMD .

  • Cellular interference: Random X-inactivation in heterozygous females creates a mosaic of cells expressing either wild-type or mutant Ephrin-B1. This cellular mosaicism disrupts normal Eph/ephrin boundary formation, leading to aberrant cell sorting and migration during development. This mechanism has been confirmed through in vitro separation of wild-type and mutant EFNB1-expressing cells from patient samples .

  • Gene dosage effects: Even duplication of the EFNB1 gene can cause developmental abnormalities, as demonstrated in a family with hypertelorism where MLPA revealed duplication of all five exons of EFNB1. The duplicated allele generated approximately 1.6-fold more transcript than the normal allele, suggesting that altered expression levels (not just presence/absence) can disrupt development .

The specific phenotypic manifestations of CFNS include craniofrontonasal dysplasia, craniosynostosis, cleft palate, skeletal defects, and neurological abnormalities including corpus callosum agenesis and mental retardation .

What evidence supports Ephrin-B1's role in immune system function and potential therapeutic applications?

Emerging evidence indicates that Ephrin-B1 plays significant roles in immune system function:

  • T cell migration: Ephrin-B1 and Ephrin-B2 are involved in T cell migration to the central nervous system in both experimental autoimmune encephalomyelitis (EAE) mouse models and human contexts .

  • Viral immune responses: While B cell-specific Ephrin-B1 deficiency alone shows no effect on germinal center formation, plasmablast production, or B cell class-switching after viral infections, dual deletion of both Ephrin-B1 and Ephrin-B2 in T cells leads to defective immune responses against lymphocytic choriomeningitis virus (LCMV) .

  • Pathogen interactions: Some pathogens like Mycobacterium tuberculosis can manipulate EphA2 and ephrin-A1 expression to support granuloma formation, aiding in bacterial immune evasion .

What recombinant forms of Ephrin-B1 are available for research and how should they be used?

Several recombinant forms of human Ephrin-B1 are available for research applications, each with specific characteristics and applications:

Recombinant FormTags/ModificationsExpression SystemApplications
Ephrin-B1 Fc ChimeraC-terminal Fc tagHEK293 cellsReceptor binding assays, cell stimulation
Ephrin-B1 His-Fc TagC-terminal His & Fc tagsHEK293 cellsPurification, detection, functional studies
Ephrin-B1 ECDSequence: Met 1-Gly 232Various expression systemsStructure-function studies

When using these recombinant proteins, researchers should consider:

  • Activity validation: Confirm binding capacity through functional ELISA. For example, immobilized mouse EphB3 at 2 μg/ml can bind human EFNB1 Fc chimera with a linear range of 1.56-25 ng/ml .

  • Endotoxin levels: Ensure preparations contain <1.0 EU per μg as determined by the LAL method to prevent confounding inflammatory responses in cellular assays .

  • Storage and handling: Most preparations should be stored at -20°C to -80°C and avoid repeated freeze-thaw cycles that can compromise protein integrity.

  • Application-specific concentrations: Titrate concentrations for specific applications, typically starting with ranges from 1-100 ng/ml for cellular assays based on the linear binding range observed in ELISA studies .

How can researchers effectively study Ephrin-B1 reverse signaling in experimental systems?

Studying Ephrin-B1 reverse signaling requires specialized approaches to dissect its complex signaling mechanisms:

  • Selective pathway disruption: Generate targeted mutations that independently ablate specific reverse signaling pathways while maintaining forward signaling capacity. Key mutations include:

    • 6F mutation: Replace all six intracellular tyrosines with phenylalanine to prevent phosphorylation-dependent reverse signaling

    • ΔV mutation: Delete the valine in the PDZ-binding motif to disrupt PDZ-dependent reverse signaling

    • 6FΔV mutation: Combine both mutations to abolish all reverse signaling

  • Validation of signaling integrity: Confirm that forward signaling remains intact in reverse signaling mutants through:

    • Immunoprecipitation of EphB2 followed by phosphotyrosine immunoblotting

    • Verification that wild-type level of EphB2 tyrosine phosphorylation is maintained in reverse signaling mutants

  • Reverse signaling activation assessment: Evaluate phosphorylation-dependent reverse signaling by:

    • Immunoprecipitating Ephrin-B1 from embryonic head lysate

    • Immunoblotting with anti-Ephrin-B1 antibody to detect characteristic band shifts

    • Comparing wild-type and 6F mutant samples to confirm phosphorylation-specific changes

  • Phenotypic analysis: Assess biological outcomes such as corpus callosum formation, axon guidance, or cell migration in the presence of these selective signaling mutations to determine pathway-specific functions .

  • Co-culture assays: Employ modified co-culture systems where heterologous cells expressing EphB receptors are cultured with neurons expressing wild-type or mutant Ephrin-B1 to study trans-synaptic interactions and presynaptic development .

What advanced techniques can be used to investigate the role of Ephrin-B1 in cellular mosaicism and boundary formation?

To investigate Ephrin-B1's role in cellular mosaicism and boundary formation, researchers can employ these advanced techniques:

  • Clonal expansion of X-inactivated cells: Establish fibroblast cultures from female CFNS patients and expand clones with either wild-type or mutant EFNB1 on the active X-chromosome. This approach enables separation of cells expressing different Ephrin-B1 variants to study cellular interactions at boundaries .

  • Mosaic analysis in transgenic models: Generate chimeric or conditional knockout models with fluorescent reporters to track cells expressing different levels of Ephrin-B1. For example, the Efnb1^Lox mouse model containing human EFNB1 cDNA in place of endogenous Efnb1 can be used to study how allelic imbalance affects cell mixing during development .

  • Cell sorting and boundary formation assays: Mix labeled cells expressing wild-type and mutant Ephrin-B1 and analyze their sorting behavior over time using live-cell imaging. Quantify segregation indices to measure the extent of boundary formation between different cell populations .

  • Tissue-specific conditional knockouts: Use Cre-lox technology to delete Ephrin-B1 in specific tissues at defined developmental stages to distinguish cell-autonomous from non-cell-autonomous effects and to bypass embryonic lethality of constitutive knockouts .

  • Super-resolution microscopy: Apply techniques like STORM or PALM to visualize subcellular localization of Ephrin-B1 at cell boundaries with nanometer precision, particularly at lateral membranes where it interacts with claudins in cardiomyocytes .

  • CRISPR/Cas9-mediated mosaicism: Generate mixed cultures with defined ratios of edited and non-edited cells to model the effects of X-inactivation mosaicism in controlled experimental settings.

What are the emerging roles of Ephrin-B1 in cardiac function?

Recent research has uncovered important roles for Ephrin-B1 in cardiac function, particularly in the late postnatal developmental stage and adult heart:

  • Lateral membrane stabilization: Ephrin-B1 has been identified as a novel protein of the lateral membrane of adult cardiomyocytes, independent from the integrin or dystroglycan systems. It stabilizes the adult rod shape of cardiomyocytes through specific regulation of the lateral membrane structure .

  • Interaction with claudin-5: Ephrin-B1 directly interacts with claudin-5 at the lateral membrane of adult cardiomyocytes and controls its expression. This interaction is particularly important for maintaining crest-crest lateral interactions within the adult cardiac tissue .

  • Postnatal developmental stage: Ephrin-B1 plays a significant role during a newly identified P20-P60 postnatal developmental stage of the heart. This stage represents a critical maturation period distinct from earlier postnatal development .

  • Diastolic function regulation: Although young adult mice with cardiomyocyte-specific deletion of Efnb1 did not demonstrate contractile defects, they showed high susceptibility to cardiac stresses, suggesting a role in stress response and potentially in diastolic function .

These findings highlight Ephrin-B1 as a potential therapeutic target for cardiac diseases, particularly those involving diastolic dysfunction. Future research should focus on determining the mechanistic details of how Ephrin-B1 regulates membrane structure and function in cardiomyocytes, and whether modulation of this pathway could provide therapeutic benefits in heart failure with preserved ejection fraction.

How can researchers address the challenges of functional redundancy when studying Ephrin-B family members?

Studying Ephrin-B1 function is complicated by potential redundancy among Ephrin-B family members. Researchers can employ these strategies to address this challenge:

What cutting-edge technologies could advance our understanding of Ephrin-B1 function in development and disease?

Several emerging technologies hold promise for deepening our understanding of Ephrin-B1 biology:

  • Single-cell transcriptomics and proteomics: Apply these technologies to tissues with cellular mosaicism for Ephrin-B1 expression to understand how differential expression affects cell fate decisions and boundary formation at single-cell resolution.

  • CRISPR-based lineage tracing: Combine CRISPR/Cas9 editing with lineage tracing to track the developmental trajectory of cells with different Ephrin-B1 expression levels or mutations in vivo.

  • Optogenetic control of Ephrin-B1 signaling: Develop light-inducible Ephrin-B1 variants to achieve spatiotemporal control of signaling, allowing precise manipulation of forward and reverse signaling in specific cellular contexts.

  • Cryo-electron microscopy: Apply this technique to visualize the structure of Ephrin-B1 in complex with its binding partners at atomic resolution, providing insights into the structural basis of signaling specificity.

  • Biomechanical force measurements: Develop tools to measure the mechanical forces generated by Ephrin-B1-mediated cell-cell interactions, particularly in contexts like the lateral membrane of cardiomyocytes where it may play a mechanical role .

  • Organoid models: Generate brain, craniofacial, or cardiac organoids from induced pluripotent stem cells with EFNB1 mutations to model development in three-dimensional tissue contexts that better recapitulate in vivo conditions.

  • In vivo imaging: Utilize advanced microscopy techniques to visualize Ephrin-B1-mediated cell sorting and boundary formation in living organisms during development.

These technologies could help resolve outstanding questions about how Ephrin-B1 coordinates diverse developmental processes and how its dysfunction contributes to conditions like craniofrontonasal syndrome and cardiac disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.