Recombinant Human Epidermal retinol dehydrogenase 2 (SDR16C5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SDR16C5; RDHE2; Epidermal retinol dehydrogenase 2; EPHD-2; RDH-E2; Retinal short-chain dehydrogenase reductase 2; retSDR2; Short-chain dehydrogenase/reductase family 16C member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SDR16C5
Target Protein Sequence
MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF ARLGSVLVLWDINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVS ILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAG LSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPS LLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMD GFVDQKKKL
Uniprot No.

Target Background

Function
Recombinant Human Epidermal retinol dehydrogenase 2 (SDR16C5) is an oxidoreductase with a strong preference for NAD. It exhibits activity in both oxidative and reductive directions, oxidizing all-trans-retinol to all-trans-retinaldehyde. No activity was observed with 11-cis-retinol or 11-cis-retinaldehyde as substrates using either NAD+/NADH or NADP+/NADPH.
Gene References Into Functions
  1. Mapped to chromosome 8; may contribute to psoriasis pathogenesis through its role in retinol metabolism and keratinocyte proliferation. PMID: 12372410
Database Links

HGNC: 30311

OMIM: 608989

KEGG: hsa:195814

STRING: 9606.ENSP00000307607

UniGene: Hs.170673

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in adult lung. Detected at low levels in adult brain, heart, testis, placenta, cervix, pancreas, uterus, stomach, rectum, small intestine, colon, esophagus, thymus, skin, and skin keratinocyte. Expression is higher in psoriasis lesions relative t

Q&A

What is SDR16C5 and what is its primary function?

SDR16C5, or Epidermal Retinol Dehydrogenase 2, is a member of the short-chain dehydrogenase/reductase superfamily of proteins that catalyzes the oxidation of retinol (vitamin A) to retinaldehyde, an essential precursor for retinoic acid biosynthesis. The enzyme is primarily expressed in epidermal tissues and is localized to the endoplasmic reticulum membrane, where it participates in the retinol metabolism pathway . Its enzymatic activity involves NAD+/NADH as preferred cofactors, suggesting it primarily functions in the oxidative direction in vivo . This oxidation step is critical as it represents the rate-limiting reaction in retinoic acid synthesis, which subsequently regulates numerous biological processes including cell differentiation, proliferation, and apoptosis.

How is SDR16C5 structurally characterized?

SDR16C5 is structurally characterized as a member of the short-chain dehydrogenase/reductase (SDR) superfamily. The protein contains the characteristic Rossmann fold for nucleotide binding and conserved active site residues typical of SDR enzymes . When expressed in research contexts, it is commonly created as a fusion protein with C-terminal tags (His6-tag or FLAG-tag) for purification and detection purposes . The enzyme appears to be membrane-associated, particularly with the endoplasmic reticulum, which is consistent with its role in retinoid metabolism . It shares approximately 43% sequence homology with RDH10 (SDR16C4), another important retinol dehydrogenase . This structural organization facilitates its function in converting retinol to retinaldehyde, with specific activity toward all-trans-retinoids, though at lower levels compared to other retinoid-active SDRs like human RoDH4 or RDH10 .

How does SDR16C5 contribute to retinoic acid biosynthesis compared to other retinol dehydrogenases?

What are the implications of SDR16C5 overexpression in cancer progression?

Recent research has revealed significant implications of SDR16C5 overexpression in cancer progression, particularly in pancreatic adenocarcinoma (PAAD). Higher expression of SDR16C5 is significantly associated with poorer survival outcomes in multiple cancer types . Functional studies demonstrate that knockdown of SDR16C5 inhibits PAAD cell proliferation and promotes apoptosis through mechanisms involving the repression of Bcl-2 and activation of caspase-dependent apoptotic pathways .

SDR16C5 appears to promote cancer cell migration and invasion by facilitating epithelial-mesenchymal transition (EMT), a critical process in cancer metastasis . Molecular pathway analyses suggest that SDR16C5 may exert these oncogenic effects through interactions with the IL-17 signaling pathway, linking it to inflammatory processes that contribute to cancer development . The enzyme's role in retinoid metabolism may also contribute to its oncogenic properties, as dysregulated retinoic acid signaling has been implicated in various malignancies.

The multi-faceted involvement of SDR16C5 in cancer biology—affecting proliferation, apoptosis resistance, migration, and invasion—positions it as a potential prognostic biomarker and therapeutic target. These findings suggest that targeting SDR16C5 could simultaneously address multiple hallmarks of cancer, making it an attractive subject for cancer research and drug development efforts.

How do SDR16C5 and SDR16C6 cooperate in skin physiology, and what are the consequences of their deficiency?

SDR16C5 and SDR16C6 (also known as RDHE2 and RDHE2S, respectively) demonstrate functional cooperation in skin physiology through overlapping expression patterns and complementary enzymatic activities. These enzymes share significant sequence homology (approximately 43%) with RDH10 and appear to work in concert to regulate retinoid metabolism in skin tissues . While SDR16C6 exhibits higher catalytic activity in retinoic acid production (15-fold increase versus 3-fold for SDR16C5), both enzymes contribute to the oxidation of retinol to retinaldehyde in skin .

  • Accelerated hair growth after shaving

  • Enlarged meibomian glands

  • Up-regulation of hair-follicle stem cell genes

  • Nearly 80% reduction in retinol dehydrogenase activities in skin membrane fractions

These phenotypic changes are consistent with reduced retinoic acid signaling in the skin, underscoring the importance of these enzymes in maintaining normal skin physiology. Despite these alterations, DKO mice remain viable and fertile, indicating that while SDR16C5 and SDR16C6 are not critical for survival, they play essential roles in regulating the hair-follicle cycle and maintaining both sebaceous and meibomian glands . This suggests a specialized rather than universal requirement for these enzymes in retinoid metabolism.

What are the recommended methods for expressing and purifying recombinant SDR16C5?

For successful expression and purification of recombinant SDR16C5, researchers should consider the following methodological approach based on published protocols:

Expression System Selection:

  • Eukaryotic expression: HEK293 cells have been successfully used with the pCMV-Tag4a vector system incorporating a C-terminal FLAG-tag for detection and purification .

  • Insect cell expression: Sf9 insect cells with baculovirus expression systems provide higher protein yields and proper post-translational modifications. The pVL1393 baculovirus transfer vector with a C-terminal His6-tag has proven effective .

Cloning Strategy:

  • Amplify the full-length SDR16C5 cDNA using PCR with primers containing appropriate restriction sites (EcoRI/XhoI for mammalian expression; XbaI/NotI for insect cell expression) .

  • Clone the PCR product into the selected expression vector in-frame with the C-terminal tag.

  • Verify the construct by sequencing to confirm correct insertion and absence of mutations.

Expression Protocol:

  • For HEK293 cells, transfect using Lipofectamine according to manufacturer's instructions.

  • For Sf9 cells, co-transfect with the transfer vector and linearized baculovirus DNA to generate recombinant baculovirus.

  • Express at optimal temperature (37°C for mammalian cells; 27°C for insect cells).

Purification Procedure:

  • Harvest cells and prepare membrane fractions since SDR16C5 is membrane-associated.

  • Solubilize membrane proteins using appropriate detergents (e.g., CHAPS, Triton X-100).

  • For His6-tagged protein, purify using Ni2+-affinity chromatography.

  • For FLAG-tagged protein, use anti-FLAG affinity chromatography.

  • Elute with appropriate buffers containing imidazole (for His-tag) or FLAG peptide (for FLAG-tag).

  • Perform dialysis to remove excess imidazole or FLAG peptide.

This methodology ensures proper expression and purification of functional SDR16C5 suitable for subsequent enzymatic and structural characterization .

What assays are recommended for measuring SDR16C5 enzymatic activity?

To accurately measure SDR16C5 enzymatic activity, researchers should employ the following validated assay methodologies:

Spectrophotometric NAD(P)H Assays:

  • Monitor the reduction of NAD+ to NADH at 340 nm during the oxidation of retinol to retinaldehyde.

  • Typical reaction conditions include:

    • 100 mM sodium phosphate buffer (pH 7.4)

    • 1 mM NAD+ (preferred cofactor)

    • 50-100 μM all-trans-retinol as substrate

    • Purified enzyme or membrane fractions containing SDR16C5

  • Calculate specific activity as nmol of NADH formed per minute per mg of protein .

HPLC-Based Retinoid Analysis:

  • Incubate purified enzyme or cellular fractions with retinol substrate and appropriate cofactor.

  • Extract retinoids using organic solvents (e.g., hexane/ethyl acetate).

  • Analyze by reverse-phase HPLC with UV detection at 325 nm.

  • Quantify retinaldehyde formation by comparison to authentic standards .

Cell-Based Retinoid Metabolism Assays:

  • Express SDR16C5 in appropriate cell lines (e.g., HEK293).

  • Incubate transfected cells with radiolabeled retinol or unlabeled retinol.

  • Extract cellular retinoids and analyze by HPLC or TLC.

  • Compare retinaldehyde and retinoic acid production between SDR16C5-expressing cells and control cells .

Microsomal Assays for Tissue Samples:

  • Prepare microsomal fractions from tissue samples (particularly skin tissues).

  • Incubate microsomes with retinol substrate and NAD+.

  • Measure retinaldehyde formation using HPLC or spectrophotometric methods.

  • Calculate enzymatic activity per mg of microsomal protein .

When performing these assays, researchers should note that SDR16C5 exhibits lower specific activity toward all-trans-retinoids compared to other retinoid-active SDRs, which may necessitate longer incubation times or higher enzyme concentrations for reliable measurements .

How can researchers effectively establish and validate SDR16C5 knockdown or knockout models?

Establishing and validating effective SDR16C5 knockdown or knockout models requires systematic approaches tailored to the research questions. Based on published methodologies, researchers should consider the following comprehensive strategy:

siRNA-Mediated Knockdown:

  • Design multiple siRNA sequences targeting different regions of SDR16C5 mRNA.

  • Transfect target cells (e.g., PANC-1 and SW1990 for pancreatic cancer studies) using established transfection reagents.

  • Include appropriate negative controls (siRNA-NC with scrambled sequence).

  • Validate knockdown efficiency at both mRNA level (qRT-PCR) and protein level (Western blot) .

CRISPR/Cas9 Knockout Strategy:

  • Design guide RNAs targeting early exons of the SDR16C5 gene.

  • Transfect cells with CRISPR components using appropriate delivery methods.

  • Select and isolate single cell clones.

  • Validate knockout through genomic PCR, sequencing, RT-PCR, and Western blot.

  • Consider potential compensatory mechanisms, particularly from the related enzyme SDR16C6 .

Animal Knockout Models:

  • For mouse models, consider both single knockout (SKO) and double knockout (DKO) approaches for SDR16C5 and the functionally related SDR16C6.

  • Verify knockout through genotyping and expression analysis in target tissues.

  • Systematically assess phenotypes with particular attention to:

    • Skin and hair follicle development

    • Sebaceous and meibomian gland function

    • Retinol metabolism in skin and other relevant tissues

Validation of Model Systems:

  • Enzymatic Activity Assessment: Measure retinol dehydrogenase activity in membrane fractions from knockout/knockdown models compared to wild-type controls .

  • Molecular Characterization: Analyze expression of related genes to identify potential compensatory mechanisms.

  • Functional Assays: Based on the research question, perform appropriate functional assays:

    • For cancer studies: proliferation, migration, invasion, and apoptosis assays

    • For skin physiology: analysis of hair cycle, sebaceous gland function, and epidermal differentiation

  • Rescue Experiments: Reintroduce wild-type SDR16C5 to confirm that observed phenotypes are directly attributable to SDR16C5 deficiency.

This comprehensive approach ensures reliable model systems that can provide valid insights into SDR16C5 function in both physiological and pathological contexts.

How should researchers interpret contradictory data regarding SDR16C5 function in different tissues?

When faced with contradictory data regarding SDR16C5 function across different tissues, researchers should employ a systematic analytical framework:

Context-Dependent Analysis:

  • Recognize that SDR16C5 may have tissue-specific functions due to different cellular environments, cofactor availability, and substrate concentrations. For instance, while SDR16C5 promotes normal retinoid metabolism in skin tissues , it appears to contribute to aberrant cell proliferation in pancreatic cancer .

  • Consider the presence of functionally redundant enzymes in different tissues. The minimal phenotype observed in single SDR16C5 knockout models compared to the more pronounced effects in double knockout models (with SDR16C6) illustrates how functional redundancy can mask tissue-specific roles .

  • Examine the expression levels of SDR16C5 across tissues using standardized methods (qRT-PCR, Western blot) and correlate these with observed functional effects. The high expression in skin corresponds with its significant contribution to retinol metabolism in epidermal tissues .

Methodological Reconciliation:

  • Compare experimental approaches, noting that in vitro enzymatic assays may not fully recapitulate the in vivo environment. For example, purified SDR16C5 shows lower specific activity toward retinoids in vitro , yet contributes significantly to retinol metabolism in intact cells .

  • Evaluate differences in model systems—cell lines, primary cultures, animal models—as each has inherent limitations. The physiological relevance of findings in cancer cell lines versus knockout mouse models should be considered within their respective contexts.

  • Standardize analytical methods when comparing across studies. Different assay conditions can significantly impact enzymatic activity measurements and functional outcomes.

Integrative Interpretation Framework:

  • Develop a unified model that accommodates tissue-specific variations in SDR16C5 function, considering:

    • Differential expression patterns

    • Varying substrate availability

    • Presence of complementary enzymes

    • Disease-specific alterations in signaling pathways

  • When contradictions persist, prioritize findings from studies with the most physiologically relevant models and robust validation approaches, while acknowledging limitations and remaining questions.

This structured approach to data interpretation recognizes the biological complexity underlying seemingly contradictory findings and provides a framework for developing more comprehensive models of SDR16C5 function.

What statistical approaches are most appropriate for analyzing SDR16C5 expression correlation with clinical outcomes?

When analyzing correlations between SDR16C5 expression and clinical outcomes, researchers should employ rigorous statistical methodologies tailored to the specific research questions and data characteristics:

Survival Analysis Approaches:

Expression Correlation Analysis:

  • Differential Expression Analysis:

    • Use appropriate statistical tests (Wilcoxon or t-test) to compare SDR16C5 expression between tumor and normal tissues

    • Apply multiple testing corrections (e.g., Benjamini-Hochberg)

    • Present results with adjusted p-values and fold change values

  • Correlation with Clinical Parameters:

    • Use Spearman or Pearson correlation for continuous variables

    • Apply Chi-square or Fisher's exact test for categorical variables

    • Present correlation coefficients with confidence intervals and p-values

Predictive Performance Assessment:

  • ROC Curve Analysis:

    • Generate time-dependent ROC curves to assess the predictive power of SDR16C5 expression

    • Calculate area under the curve (AUC) values with confidence intervals

    • Compare predictive performance at different time points

  • Risk Score Development:

    • Establish a risk score system based on SDR16C5 expression

    • Validate predictive performance in independent cohorts when available

    • Use Harrell's C-index to measure discrimination ability

Implementation Guidelines:

  • Use established statistical software (R v4.0.3 or later) with appropriate packages (survival, survminer, timeROC)

  • Set statistical significance threshold consistently (typically p < 0.05)

  • Report both significant and non-significant findings

  • Include sample size and power calculations

  • Address potential confounding factors and biases

How can researchers effectively analyze the role of SDR16C5 in immune regulation based on transcriptomic data?

To effectively analyze SDR16C5's role in immune regulation using transcriptomic data, researchers should implement a comprehensive analytical pipeline that integrates multiple computational approaches:

Correlation Analysis with Immune Genes:

  • Perform correlation analysis between SDR16C5 expression and known immune-related genes across samples.

  • Select genes with statistically significant correlations (p < 0.001) and substantial correlation coefficients (r > 0.5 or r < -0.5) for further analysis .

  • Visualize these correlations using heatmaps and scatter plots to identify patterns of co-expression.

Pathway Enrichment Analysis:

  • Conduct Gene Ontology (GO) analysis focusing on immune-related biological processes, molecular functions, and cellular components.

  • Perform KEGG pathway analysis to identify signaling pathways connecting SDR16C5 to immune regulation.

  • Special attention should be given to the IL-17 signaling pathway, which has been implicated in SDR16C5-mediated effects .

  • Present enrichment results with adjusted p-values and enrichment ratios.

Immune Cell Infiltration Analysis:

  • Utilize computational deconvolution methods through the immunedeconv R package to estimate immune cell subset abundance from transcriptomic data.

  • Compare immune cell profiles between high and low SDR16C5 expression groups.

  • Identify specific immune cell populations that show differential abundance between these groups .

  • Validate key findings using orthogonal methods such as immunohistochemistry or flow cytometry when possible.

Differential Gene Expression Analysis:

  • Divide samples into high and low SDR16C5 expression groups based on appropriate thresholds.

  • Perform differential expression analysis to identify genes significantly altered between these groups.

  • Focus analysis on immune regulatory genes and pathways.

  • Validate key differentially expressed genes by qRT-PCR or protein-level assays.

Integrated Network Analysis:

  • Construct gene regulatory networks centered on SDR16C5 and immune-related genes.

  • Identify key hub genes and regulatory motifs connecting SDR16C5 to immune processes.

  • Use tools like Cytoscape for network visualization and analysis.

Experimental Validation Strategies:

  • Based on computational findings, design targeted experiments to validate key immune regulatory mechanisms:

    • Analyze immune cell infiltration in tissues with manipulated SDR16C5 expression

    • Assess cytokine production and signaling in response to SDR16C5 modulation

    • Evaluate changes in immune checkpoint molecules

By systematically implementing this analytical workflow, researchers can generate robust hypotheses about SDR16C5's role in immune regulation and design focused experimental approaches to validate these computational findings .

What are the most promising therapeutic applications targeting SDR16C5?

Based on current understanding of SDR16C5 biology, several promising therapeutic applications warrant further investigation:

Oncology Applications:

  • Small Molecule Inhibitors: Developing specific inhibitors of SDR16C5 enzymatic activity could potentially suppress cancer cell proliferation, migration, and invasion. This approach is particularly promising for pancreatic cancer, where SDR16C5 overexpression correlates with poor survival .

  • Combination Therapies: SDR16C5 inhibition could potentially sensitize cancer cells to conventional chemotherapeutics or immunotherapies by interrupting survival pathways. Research should focus on identifying synergistic drug combinations that enhance efficacy while minimizing toxicity.

  • Biomarker Development: SDR16C5 expression levels could serve as prognostic biomarkers to stratify patients and guide treatment decisions, particularly in pancreatic, laryngeal, and colorectal cancers where its overexpression has been documented .

Dermatological Applications:

  • Psoriasis Treatment: Given SDR16C5's elevated expression in psoriatic skin and its role in retinoid metabolism, targeting this enzyme could provide a novel approach for psoriasis management . Topical formulations might allow for targeted delivery with minimal systemic effects.

  • Hair Growth Regulation: The accelerated hair growth observed in SDR16C5/SDR16C6 double-knockout mice suggests therapeutic potential for hair loss disorders . Selective inhibitors could potentially stimulate hair growth in conditions like androgenetic alopecia.

  • Sebaceous Gland Disorders: SDR16C5's involvement in sebaceous gland maintenance points to possible applications in conditions like acne or seborrheic dermatitis .

Technological Development Requirements:

  • Structure-Based Drug Design: Elucidating the three-dimensional structure of SDR16C5 would facilitate rational drug design efforts. Crystallography or cryo-EM studies should be prioritized.

  • Targeted Delivery Systems: Developing tissue-specific delivery systems (e.g., nanoparticles, liposomes) could enhance therapeutic efficacy while minimizing off-target effects.

  • Gene Therapy Approaches: For conditions where SDR16C5 deficiency is beneficial, CRISPR-based gene editing or RNA interference technologies could provide long-term therapeutic solutions.

These therapeutic applications represent promising avenues for translating basic SDR16C5 research into clinical interventions, though significant preclinical validation and early-phase clinical trials will be necessary to establish safety and efficacy profiles.

What experimental approaches would best elucidate the regulatory mechanisms controlling SDR16C5 expression?

To comprehensively elucidate the regulatory mechanisms controlling SDR16C5 expression, researchers should employ a multi-faceted experimental approach:

Transcriptional Regulation Studies:

  • Promoter Analysis: Identify the core promoter and regulatory elements of the SDR16C5 gene using reporter assays with progressive deletion constructs. This would delineate minimal promoter regions and enhancer/silencer elements.

  • Transcription Factor Identification:

    • Perform chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors binding the SDR16C5 promoter region

    • Use electrophoretic mobility shift assays (EMSA) to confirm specific binding interactions

    • Validate functional importance through mutation analysis of binding sites in reporter assays

  • Epigenetic Regulation Assessment:

    • Analyze DNA methylation patterns in the SDR16C5 promoter across different tissues and disease states using bisulfite sequencing

    • Investigate histone modifications through ChIP-seq for marks like H3K4me3, H3K27ac, and H3K27me3

    • Employ ATAC-seq to assess chromatin accessibility at the SDR16C5 locus

Post-Transcriptional Regulation Analysis:

  • miRNA Targeting:

    • Identify potential miRNA binding sites in SDR16C5 mRNA using bioinformatic prediction tools

    • Validate miRNA interactions through luciferase reporter assays with wild-type and mutated 3'UTR sequences

    • Confirm functional relevance by manipulating miRNA levels and measuring effects on SDR16C5 expression

  • mRNA Stability Studies:

    • Measure SDR16C5 mRNA half-life using actinomycin D chase experiments in different cellular contexts

    • Identify RNA-binding proteins that regulate SDR16C5 mRNA stability using RNA immunoprecipitation (RIP) assays

Signaling Pathway Investigations:

  • Pathway Perturbation:

    • Systematically modulate major signaling pathways (MAPK, JAK/STAT, NF-κB, Wnt, etc.) using small molecule inhibitors or activators

    • Measure resulting changes in SDR16C5 expression at mRNA and protein levels

    • Pay particular attention to retinoid signaling pathways given SDR16C5's function in retinoid metabolism

  • Tissue-Specific Regulatory Networks:

    • Compare regulatory mechanisms between tissues with high SDR16C5 expression (skin) and pathological contexts (cancer)

    • Identify tissue-specific transcription factors and cofactors using tissue-specific ChIP-seq

Integrative Single-Cell Approaches:

  • Employ single-cell RNA-seq to characterize SDR16C5 expression heterogeneity across cell populations

  • Integrate with single-cell ATAC-seq to correlate expression with chromatin accessibility patterns

  • Develop integrative computational models to predict cell-type specific regulatory mechanisms

By systematically implementing these experimental approaches, researchers can construct a comprehensive model of SDR16C5 regulation across different physiological and pathological contexts, potentially revealing new therapeutic opportunities for modulating its expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.