Recombinant Human Epithelial cell adhesion molecule (EPCAM)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Epithelial Cell Adhesion Molecule (EpCAM)

Recombinant Human Epithelial Cell Adhesion Molecule (EpCAM), also known as CD326, is a type I transmembrane glycoprotein that plays a crucial role in cell adhesion, signaling, and various cellular processes such as proliferation and differentiation. It is primarily expressed in epithelial tissues and is particularly noted for its overexpression in various carcinomas, making it a significant marker in cancer research and therapy .

Production and Characteristics of Recombinant EpCAM

Recombinant Human EpCAM is produced by cloning the EpCAM gene fragment into an expression vector designed for E. coli systems. The N-terminal 6xHis-SUMO tag gene is inserted into the vector to facilitate purification. Once expressed, the cells are lysed, and the EpCAM protein is captured using affinity chromatography. The purity of the recombinant EpCAM protein is assessed using SDS-PAGE, confirming a high degree of purity, greater than 90%, making it ideal for experimental use .

Characteristics of Recombinant EpCAM:

CharacteristicDescription
Protein TypeType I transmembrane glycoprotein
Expression SystemE. coli
Purity>90%
TagN-terminal 6xHis-SUMO
FunctionCell adhesion, signaling, proliferation, differentiation

Biological Functions of EpCAM

EpCAM is involved in diverse biological processes, including cell-cell adhesion, cell migration, proliferation, and differentiation. It interacts with various molecules such as claudins, CD44, E-cadherin, and components of the WNT and Ras/Raf pathways, contributing to intratumor heterogeneity and epithelial-to-mesenchymal transition (EMT) .

Biological Functions of EpCAM:

FunctionDescription
Cell AdhesionMediates interactions between epithelial cells
Cell MigrationInfluences migration rate through interactions with α-actinin
ProliferationAffects cell proliferation, potentially through signaling pathways
DifferentiationImpacts cell differentiation by disrupting EpCAM-mediated interactions

Clinical Significance of EpCAM

EpCAM serves as a prognostic marker and therapeutic target due to its frequent and high expression on carcinomas and their metastases. It is used in the detection of circulating tumor cells (CTCs), which are predictive of short survival in several cancers and can guide therapy .

Clinical Applications of EpCAM:

ApplicationDescription
Prognostic MarkerPredicts clinical outcomes in carcinoma patients
Therapeutic TargetTarget for cancer therapies due to its role in tumor progression
CTC DetectionUsed in liquid biopsies to detect CTCs, aiding in cancer diagnosis and monitoring

Research Findings and Future Directions

Recent studies highlight the importance of EpCAM in cancer biology, particularly in understanding metastasis and EMT. The detection of EpCAM-positive and EpCAM-negative CTCs has shown that EpCAM-positive CTCs are associated with poor outcomes, while EpCAM-negative CTCs require further characterization .

Future Research Directions:

  1. Molecular Characterization: Further studies are needed to elucidate the differences between EpCAM-positive and EpCAM-negative CTCs.

  2. Therapeutic Strategies: Developing targeted therapies against EpCAM could improve cancer treatment outcomes.

  3. Liquid Biopsy Techniques: Enhancing methods for detecting EpCAM-positive and EpCAM-negative CTCs could improve cancer diagnostics.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2; 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component; chromosome 4; surface marker 1; Membrane component; chromosome 4; surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-314
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Uniprot No.

Target Background

Function
Epithelial cell adhesion molecule (EpCAM) may function as a homophilic adhesion molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs), contributing to the immunological barrier at the mucosal epithelium and providing a first line of defense against mucosal infection. It also plays a role in embryonic stem cell proliferation and differentiation and upregulates the expression of FABP5, MYC, and cyclins A and E.
Gene References Into Functions
  1. This study introduced a novel approach using a combination of EpCAM and FRα as CTC-capture targets to enhance the sensitivity, specificity, and speed of CTC detection in NSCLC. PMID: 29352248
  2. Review: Functions of EpCAM in physiological processes and diseases. PMID: 30015855
  3. Our research suggests that GA733-2-Fc conjugated to the ER-retention motif KDEL is a more effective antigen for inhibiting colorectal carcinoma-induced tumor growth while minimizing allergic responses. PMID: 30249898
  4. Extracellular vesicles exhibit a tendency to localize in the intestinal tract, associating with epithelial cell adhesion molecule. PMID: 27721471
  5. Overexpression of EpCAM and melan-A is linked to malignant melanoma. PMID: 29076925
  6. Quercetin suppressed breast cancer stem cell proliferation, self-renewal, and invasiveness, while also downregulating proteins associated with tumorigenesis and cancer progression, such as ALDH1A1, CXCR4, MUC1, and EpCAM. PMID: 29353288
  7. Adenocarcinomas displayed significantly higher staining scores for VEGF and αSMA compared to squamous cell carcinomas. Patients with lung cancer exhibiting mature tumor vessels (high CD31 score) demonstrated a significantly better five-year survival rate (87%) than those with immature vessels (69%). PMID: 29970536
  8. A novel EPCAM founder deletion causing Lynch Syndrome has been identified in the Polish population. PMID: 28369810
  9. Review: This work provides updated insights into EpCAM's biological role and highlights promising therapeutic approaches utilizing antibodies and vaccines against various cancers to improve patient outcomes. PMID: 29759567
  10. This study demonstrates that the low sensitivity of CellSearch® in detecting circulating tumor cells in colorectal cancer patients is not attributable to EpCAM deficiency. PMID: 28604994
  11. Epithelial cell adhesion molecule (EpCAM) can serve as an additional distinguishing marker for cystic lesions of the sellar region. PMID: 27431859
  12. Epithelial cell adhesion molecule (EpCAM) exhibits high tumor distinctiveness. PMID: 28820475
  13. Low expressions of Oct4-EpCAM (IHC) and CD133 (qPCR) may play roles in gastric cancer. PMID: 27557490
  14. EpCAM expression contributes to chemotherapy resistance in ovarian cancer patients. PMID: 28574829
  15. EpCAM expression is associated with colorectal cancer (CRC) carcinogenesis, while its loss correlates with disease progression, metastasis, and poor prognosis, suggesting its potential as a diagnostic biomarker for CRC. PMID: 28558958
  16. A positive correlation exists between EpCAM and COX-2 expression in breast cancer cell lines and tissue specimens, and both are linked to patient prognosis. PMID: 28393249
  17. CD133+ cells exhibited genetic heterogeneity among patients, lacking a defined profile compared to CD133-/EpCAM+ cells. PMID: 28347289
  18. Combining E-cadherin, EMA, Her2/neu, and CEA enabled near-complete detection of ductal ovarian metastases, while EMA, Her2/neu, and EpCAM were most effective for detecting lobular metastases. PMID: 28327103
  19. Whole-genome sequencing identified the homozygous intronic variant EPCAM c.556-14A>G, explaining the patient's intractable diarrhea and leading to a diagnosis of congenital tufting enteropathy. PMID: 28701297
  20. Low EPCAM expression is associated with colorectal carcinoma. PMID: 26528695
  21. EpCAM intracellular domain is a predictor of cancer development in patients with oral dysplasia and recurrence in oral squamous cell carcinoma. PMID: 27421772
  22. Elevated EpCAM mRNA+ CTC and Treg/CD4+ levels are associated with early recurrence of hepatocellular carcinoma (HCC) and poor prognosis. PMID: 27439521
  23. This research provides insights into EpCAM expression regulation during EMT, revealing its unexpected role in ERK regulation and a novel negative feedback loop between EpCAM and ERK impacting EMT regulation. PMID: 28192403
  24. This study highlights the potential of an EpCAM-specific NIR-fluorescent agent, combined with an intraoperative imaging system, for tumor visualization during surgery. PMID: 27842504
  25. Studies have characterized and determined the function of EpCAM glycosylation sites on breast cancer cell adhesion. PMID: 28315854
  26. This research identifies EpCAM as a matriptase substrate and links HAI-2, matriptase, EpCAM, and claudin-7 in a functionally important pathway that contributes to disease when dysregulated. PMID: 28094766
  27. The EpCAM aptamer-conjugated NCS demonstrated specificity to EpCAM-positive cells. PMID: 28668853
  28. Pseudomyxoma peritonei ubiquitously express CEA and EpCAM. PMID: 27038681
  29. This study explored the relationship between EpCAM-regulated transcription and altered cellular biophysical properties that promote epithelial-mesenchymal transition (EMT) in advanced endometrial cancer. PMID: 27569206
  30. Using next-generation sequencing (NGS), NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as evidenced by upregulation of CXCR4, EpCAM, CD133, and CD44 at the mRNA and protein levels. PMID: 28126340
  31. Adipocyte-secreted factors may regulate cancer stem cell behavior through signaling molecules including c-Met, STAT3, and ERK1/2, suggesting that inhibiting these pathways could represent novel therapeutic strategies targeting adipose-derived cytokine effects in cancer. PMID: 27131739
  32. Review: Meta-analysis demonstrated greater EpCAM expression in the gastric cancer group compared to the control group, and EpCAM overexpression was associated with larger tumor size, lymph node metastasis, and worse prognosis. PMID: 28403178
  33. Higher EpCAM(MT) expression is associated with a more aggressive phenotype and poor survival in colorectal cancer patients. PMID: 26996277
  34. Higher epithelial cell adhesion molecule (EpCAM) levels in breast cancer may correlate with poor response to neoadjuvant chemotherapy (NAC) through a potential chemoresistance mechanism. PMID: 27041736
  35. This nanobiosensor enables sensitive and selective EpCAM protein detection with a linear detection range from 3 nM to 54 nM and a limit of detection (LOD) around 450 pM. It has also been successfully used for detecting EpCAM-expressing MCF-7 breast cancer cells. PMID: 27614683
  36. EpCAM, CD44, and CD133 expression may serve as candidate markers for Barrett esophagus disease progression. PMID: 28216140
  37. These findings offer insights into epithelial cell adhesion molecule apoptosis regulation and suggest EpCAM as a potential target for breast cancer treatment. PMID: 28349835
  38. Epithelial cell adhesion molecule demonstrated varying expression patterns among salivary gland neoplasms and different grades of mucoepidermoid carcinomas. PMID: 27649957
  39. This peptide may serve as a valuable supplement to EpCAM antibodies for capturing circulating tumor cells (CTCs) in microfluidic systems, offering broader detection capabilities. PMID: 27818051
  40. This study characterized congenital tufting enteropathy in Italian patients, identifying three mutations in the EpCAM gene. PMID: 26684320
  41. EpCAM serves as a prognostic biomarker for identifying high-risk oral squamous cell carcinoma patients and predicting survival. PMID: 26401964
  42. The EGF-like domain of EpCAM is cleaved in cancer cells undergoing epithelial-mesenchymal transition. PMID: 26775583
  43. EpCAM is suitable as an EC biomarker, therapeutic target, and parameter for tumor transfer and prognosis evaluation using aptamer SYL3C staining. PMID: 26687301
  44. CHD4 was abundantly expressed in EpCAM(+) hepatocellular carcinoma with hepatic stem cell marker expression and poor prognosis in two independent cohorts. PMID: 26095183
  45. Doxorubicin exposure reduced EpCAM-positive cell counts in three HCC cell lines, and EpCAM siRNA knockdown attenuated cell mortality after doxorubicin exposure. PMID: 26984381
  46. EpCAM-based capture detects and recovers circulating tumor cells from all breast cancer subtypes except those with low claudin expression. PMID: 26556851
  47. Increased EPCAM mRNA expression is associated with recurrence after curative resection of hepatocellular carcinoma. PMID: 25791790
  48. This study revealed a novel mechanism of MTA1-mediated invasion and metastasis in lung cancer through EpCAM, suggesting that interfering with EpCAM function could be a new therapeutic strategy for MTA1-overexpressing lung carcinoma. PMID: 26698569
  49. EpCAM knockdown inhibits breast cancer cell growth and metastasis by suppressing the Ras/Raf/ERK signaling pathway and MMP-9. PMID: 26356670
  50. Anti-epithelial cell adhesion molecule (EpCAM) monoclonal antibodies show potential for cancer-targeted therapy. PMID: 26317650
Database Links

HGNC: 11529

OMIM: 185535

KEGG: hsa:4072

STRING: 9606.ENSP00000263735

UniGene: Hs.542050

Involvement In Disease
Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)
Protein Families
EPCAM family
Subcellular Location
Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.
Tissue Specificity
Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal

Q&A

What is the molecular structure of human EpCAM and how does it relate to its function?

Human EpCAM is a 38-40 kDa transmembrane glycoprotein that forms cis-dimers on the cell surface, protruding approximately 5 nm from the membrane. The protein consists of three major domains:

  • Extracellular domain (EpEX): Involved in EGFR-mediated signaling pathways and cell-cell interactions

  • Transmembrane domain: Contains a helix important for dimerization

  • Intracellular domain (EpIC): Anchors to the cytoskeleton via α-actinin and contains signaling motifs

The membrane-proximal thyroglobulin-like domains mediate lateral interactions in cis on one cell, while the membrane-distal EGF-like repeats facilitate interactions in trans between adjacent cells . This structural arrangement enables EpCAM to function as a homophilic cell adhesion molecule, though its adhesive properties are relatively weak compared to classical adhesion molecules .

How is EpCAM expression regulated at the transcriptional level?

The EPCAM gene expression is controlled through its proximal promoter region, which lacks typical TATA and CAAT boxes but contains:

  • Initiator consensus sequences and GC boxes

  • Binding sites for transcription factors including:

    • SP-1

    • Activator protein 1 (AP-1)

    • Activating protein 2 (AP2)

    • Ets family factors

    • ESE-1

    • E-pal-like transcription factors

These elements collectively contribute to the epithelial-specific expression pattern of EpCAM . The regulation is complex, as downstream signaling from EpCAM itself can feed back to influence gene expression through its cleaved intracellular domain.

What are the most effective methods for producing recombinant human EpCAM for research purposes?

Recombinant human EpCAM can be effectively produced using bacterial expression systems. A reliable protocol based on current research includes:

  • Vector construction: Create expression vectors (e.g., pQE30-EpCAM) containing the EpCAM sequence, often focusing on the extracellular domain

  • Expression conditions: Induce expression with 500 nM IPTG at 30°C for 7 hours

  • Protein recovery: Extract protein through sonication and centrifugation, which yields the recombinant protein in both soluble form and inclusion bodies

  • Verification: Confirm identity using SDS-PAGE (10%) under reducing conditions and Western blot, which should reveal a band at the predicted molecular weight (32 kDa for the extracellular domain)

  • Storage: Store purified protein at -80°C for downstream applications

This method has been successfully used to produce functional recombinant EpCAM suitable for binding studies and immunoassays.

How can researchers effectively detect and quantify EpCAM expression in tissue samples?

Several complementary methods allow for reliable detection and quantification of EpCAM:

MethodApplicationAdvantagesConsiderations
Immunohistochemistry (IHC)Tissue samplesVisualizes spatial distribution; allows semi-quantitative scoringRequires standardized scoring system; influenced by antibody selection
ELISASoluble proteinsQuantitative; high-throughputMay not detect conformational epitopes
Western BlottingProtein lysatesConfirms specific molecular weight; detects cleaved fragmentsLess quantitative; may not detect native conformations
ImmunocytochemistryCell culturesDetects native EpCAM on cell surfaceLabor-intensive; semi-quantitative

For IHC applications, researchers typically use a scoring system that categorizes staining as negative, weak, moderate, or strong based on both intensity and percentage of positive cells . Monoclonal antibodies targeting the EpCL region (amino acids 24-80) generally show better reactivity than those targeting the EpRE region (amino acids 81-265), as the EpCL domain produces higher immunogenicity .

How does EpCAM expression differ between normal and cancerous tissues?

EpCAM expression shows distinct patterns between normal and cancerous tissues:

Tissue TypeExpression PatternCharacteristics
Normal epithelial tissuesModerate, basolateralRestricted to epithelial cells; absent in mesenchymal tissues
CarcinomasOften high, circumferentialDetectable in 99 of 120 tumor categories studied
Adenocarcinomas≥90% positivityParticularly strong in gastrointestinal origins
Neuroendocrine tumorsHigh expressionStronger than in corresponding normal tissues
Germ cell tumorsHigh expressionParticularly in seminomas
Hepatocellular carcinomasLow expressionVariable between studies (0-100%)
Renal cell neoplasmsLow expressionParticularly in high-grade variants
Adrenocortical tumorsLow expressionLimited clinical utility

In breast cancer, high EpCAM expression correlates with high grade, distant metastasis, ER/PR negativity, and HER2 positivity . These differential expression patterns make EpCAM valuable for cancer diagnosis and as a therapeutic target.

What are the key domains of EpCAM and their functional significance?

EpCAM contains several functionally distinct domains:

  • Extracellular domain (EpEX):

    • EpCL region (aa 24-80): Highly antigenic; efficiently induces antibodies that recognize native EpCAM

    • EpRE region (aa 81-265): Less antigenic; fewer antibodies against this region bind native EpCAM

    • Functional role: Acts as EGFR ligand; mediates intercellular adhesion

  • Transmembrane domain:

    • Essential for cis-dimerization

    • Contains cleavage sites for regulated intramembrane proteolysis

  • Intracellular domain (EpIC):

    • Anchors to cytoskeleton via α-actinin

    • Contains PDZ binding site (aa 312-314) for interaction with signaling proteins

    • Has PKC inhibitory activity

    • When cleaved, translocates to nucleus and regulates gene expression

The EpCL region is particularly important as 66.3% of antibodies directed against this domain can recognize native EpCAM on cell surfaces, compared to only 5.5% of antibodies targeting the EpRE region .

How does regulated intramembrane proteolysis (RIP) of EpCAM influence its signaling capabilities?

EpCAM undergoes a two-step proteolytic process that dramatically alters its signaling functions:

  • Initial cleavage: ADAM10/17 proteases cleave the extracellular domain, releasing soluble EpEX

    • Trigger: Cell-to-cell contact or other activation signals

    • Result: EpEX acts as ligand for EGFR, activating AKT and Erk pathways

  • Second cleavage: γ-secretase complex cleaves at ε- and γ-sites

    • Products: Soluble Aβ-like fragments and intracellular domain (EpICD)

    • Function: EpICD translocates to nucleus

  • Nuclear signaling complex: EpICD forms complexes with:

    • FHL2 (adaptor protein)

    • β-catenin (transcriptional co-activator)

    • Lef1 (transcription factor)

  • Target genes regulated:

    • Cell cycle regulators (cyclin D1)

    • Pluripotency genes

    • EMT-associated genes (affecting tight junctions and cell migration)

This proteolytic activation creates a signaling system where EpCAM fragments have distinct and sometimes opposing functions. For example, nuclear localization of EpICD in colon carcinoma correlates with metastasis and worse outcomes, while EpEX can block EMT in certain contexts .

What experimental models are available for studying EpCAM function in vitro and in vivo?

Researchers have developed multiple complementary systems to study EpCAM:

In vitro models:

  • Cell lines:

    • Epithelial cancer lines (express EpCAM naturally)

    • Ectopic expression systems (fibroblasts, L153S mammary carcinoma cells)

    • HNSCC cell lines (for EGFR-EpCAM interaction studies)

    • Keratinocytes (for differentiation studies)

  • Biochemical systems:

    • Recombinant protein binding assays

    • Truncation mutants for domain mapping

    • HIS-EpCAM constructs for interaction studies

In vivo models:

  • Transgenic mice:

    • Human EpCAM-expressing mice that model carcinoma patients

    • Valuable for studying antibody biodistribution and pharmacokinetics

  • Patient-derived samples:

    • Tissue microarrays from various tumor types

    • Circulating tumor cell analysis

The transgenic mouse models are particularly valuable for evaluating EpCAM-targeting therapeutics before clinical trials, as they can reveal significant differences in tissue distribution and blood clearance between different antibody formats .

What is the current understanding of EpCAM's dual role in cell adhesion and proliferation?

EpCAM exhibits seemingly contradictory functions in adhesion and proliferation:

Adhesion functions:

  • Initially characterized as promoting cell-cell adhesion when ectopically expressed

  • Forms functional tetramers that initiate cell adhesion complexes

  • Paradoxically, can decrease adhesion by disrupting E-cadherin/α-catenin/F-actin interactions in epithelial cells

  • This disruption depends on PI3K activation

  • May primarily support adhesion mediated by other molecules (claudins, cadherins) rather than functioning independently

Proliferation functions:

  • EpICD regulates cell cycle progression through cyclin D1 regulation

  • Acts via nuclear complexes with FHL2, β-catenin, and Lef1

  • EpEX fragment induces mild proliferation through EGFR-dependent pathways

  • Expression correlates with proliferative capacity in multiple cell types

This dual functionality suggests that EpCAM acts as a multifunctional signaling hub rather than simply an adhesion molecule, with its specific role determined by cellular context and proteolytic processing state.

How does EpCAM contribute to epithelial-to-mesenchymal transition (EMT) and cancer metastasis?

EpCAM plays complex, sometimes opposing roles in EMT and metastasis:

Pro-EMT/metastasis functions:

  • Activation of EpCAM RIP through EGFR signaling releases EpICD

  • EpICD activates EMT-relevant genes in cooperation with LEF-1

  • Facilitates β-catenin nuclear accumulation and HIF1α activation

  • Nuclear EpICD correlates with metastasis and poor outcomes in colon cancer

  • Serves as marker on circulating tumor cells with metastatic potential

Anti-EMT functions:

  • EpEX blocks EMT in HNSCC cells through decreased Erk1/2 activation

  • Can counteract EGF-induced EMT when present in equimolar amounts

  • EGFR-low/EpCAM-high HNSCC patients show excellent clinical outcomes

This duality suggests that the specific fragment of EpCAM (full-length vs. EpICD vs. EpEX) and the cellular context determine whether it promotes or inhibits EMT. The controversy around these opposing functions remains an active area of investigation requiring further research.

What are the challenges and contradictions in targeting EpCAM for cancer immunotherapy?

Despite EpCAM's promise as a therapeutic target, several challenges exist:

  • Variable clinical outcomes:

    • Mouse-derived antibodies show tolerable toxicity but limited efficacy

    • Humanized antibodies induce stronger responses but can cause severe pancreatitis

  • Antibody pharmacokinetics:

    • Different antibody formats behave differently in vivo

    • Some show significant uptake in normal EpCAM-expressing tissues

    • Others demonstrate preferential tumor uptake with limited normal tissue binding

  • Expression heterogeneity:

    • EpCAM positivity varies widely between studies

    • Reported ranges: 0-100% in hepatocellular carcinoma, 0-54% in epithelioid mesothelioma

    • Technical differences in detection methods contribute to variability

  • Context-dependent functions:

    • EpCAM can promote or inhibit EMT depending on context

    • Different fragments (EpEX vs. EpICD) have opposing effects

    • Therapeutic strategy must account for these complexities

These contradictions highlight the importance of antibody design, patient selection, and understanding the complex biology of EpCAM for successful therapeutic development.

What are the latest advances in developing EpCAM-targeted therapeutic approaches?

Multiple EpCAM-targeting strategies have been developed with varying success:

ApproachMechanismDevelopment StatusNotes
Monoclonal antibodiesDirect binding and immune effector activationOne FDA-approved; others in trialsPanorex® (edrecolomab) approved in 1995
ImmunotoxinsAntibody-toxin conjugatesPreclinical/early clinicalAPE (EpCAM scFv-PE38KDEL) shows antitumor activity
Adoptive cell transferEpCAM-targeting immune cellsClinical trialsPatient-specific approach
ImmunocytokinesAntibody-cytokine fusionClinical trialsEnhanced immune activation
Bispecific T-cell engagersLink T-cells to EpCAM+ tumor cellsClinical trialsLeverages T-cell cytotoxicity

Recent advances include:

  • EpAb2-6 antibody inhibits nuclear translocation of EpICD and induces apoptosis

  • Therapies that account for EpCAM's role in circulating tumor cells

  • Combination approaches that integrate with other treatment modalities

  • Adjuvant and neoadjuvant treatment strategies

These approaches continue to evolve as our understanding of EpCAM biology deepens, with particular focus on minimizing toxicity while maximizing antitumor effects.

How does EpCAM interact with other signaling pathways to regulate cancer stemness?

EpCAM functions as a signaling node that interacts with multiple pathways to influence stemness:

  • WNT pathway integration:

    • EpICD complexes with FHL2, β-catenin, and Lef1

    • Activates TCF/LEF-dependent transcription

    • Regulates genes involved in stemness and self-renewal

  • EGFR signaling crosstalk:

    • EpEX acts as EGFR ligand

    • Activates EGFR-dependent STAT3 pathway

    • Induces LIN28 upregulation, which blocks Let7 microRNA

    • Promotes pluripotency factor expression in mesenchymal stem cells

  • Hypoxia pathway connection:

    • EpICD contributes to HIF1α activation

    • Links stem cell maintenance to the hypoxic niche

    • May promote survival under stress conditions

  • Differentiation regulation:

    • Functions in embryonic stem cells, progenitors, and carcinoma stem cells

    • Balances self-renewal and differentiation

    • Contributes to maintenance of cancer stem-like populations

This interconnected signaling network explains how EpCAM influences both normal stem cell biology and cancer stem cell properties, positioning it as a key regulator of cellular plasticity and differentiation state.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.