Recombinant Human Epithelial cell adhesion molecule (EPCAM)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Composition

EpCAM, also known as KS1/4, gp40, GA733-2, 17-1A, and TROP-1, is a 40 kDa transmembrane glycoprotein consisting of three distinct domains: a 242 amino acid extracellular domain with two EGF-like repeats, a 23 amino acid transmembrane segment, and a 26 amino acid cytoplasmic domain . Human and mouse EpCAM share approximately 82% amino acid sequence identity, indicating strong evolutionary conservation . The molecular architecture of EpCAM features membrane-proximal thyroglobulin-like domains that mediate lateral interactions in cis (on the same cell), while membrane-distal EGF-like repeats facilitate interactions in trans (between adjacent cells) . This structural arrangement enables the formation of functional EpCAM tetramers that initiate cell adhesion complexes.

Expression and Distribution

EpCAM is predominantly expressed in epithelial tissues and exhibits high expression in various carcinomas and their metastases . The significant expression on tumor cells has positioned EpCAM as a valuable prognostic marker, therapeutic target, and anchor molecule on circulating and disseminated tumor cells (CTCs/DTCs), which are considered the major source of metastatic cancer cells . The expression pattern of EpCAM contributes to intratumoral heterogeneity and partial EMT, which are major determinants of clinical outcomes in carcinoma patients.

Recombinant Human EpCAM Production

Commercially available recombinant human EpCAM typically encompasses amino acids Gln24-Lys265, corresponding to the extracellular domain of the protein, with a C-terminal 6-His tag to facilitate purification and detection . These proteins are generally formulated as lyophilized preparations from a 0.2 μm filtered PBS solution and should be reconstituted at 500 μg/mL in PBS for optimal use . The production process employs mammalian expression systems to ensure proper folding and post-translational modifications essential for biological activity.

Cell Adhesion Properties

The role of EpCAM in cellular adhesion is complex and contextual. Initial characterization in murine fibroblasts and L153S mammary carcinoma cells demonstrated that ectopic EpCAM expression increased intercellular adhesion and cell aggregation in suspension . This effect was accompanied by segregation of EpCAM-positive and EpCAM-negative cells and reduced invasive growth capacity of fibroblasts.

Paradoxically, in epithelial cell lines dependent on cadherin-mediated connections, EpCAM overexpression has been observed to decrease adhesion by disrupting functional adherens junctions through interference with E-cadherin, α-catenin, and F-actin interactions . This inhibitory effect on cadherin-mediated adhesion in breast epithelial cells depends on phosphoinositide 3-kinase (PI3K) activity.

The biological activity of recombinant human EpCAM can be assessed through cell adhesion assays. When murine fibroblasts (L cells) are added to plates coated with recombinant human EpCAM/TROP-1 and human fibronectin, cell adhesion is enhanced in a dose-dependent manner, with an ED50 (effective dose for 50% response) of approximately 0.4-2.4 μg/mL .

Signaling Mechanisms

EpCAM regulates cell cycle progression and differentiation through a process called regulated intramembrane proteolysis (RIP). This signaling mechanism involves sequential cleavage steps:

  1. Initial cleavage by membrane-resident ADAM (a disintegrin and metalloproteinase) family proteases ADAM 10 and 17, which releases the ectodomain (EpEX) into the extracellular space .

  2. Subsequent cleavage of the resulting membrane-tethered C-terminal fragment (EpCAM-CTF) by the γ-secretase complex, forming an extracellular Aβ-like fragment and the intracellular EpICD fragment .

The released EpICD translocates to the nucleus where, in combination with transcription factors and adaptor molecules such as FHL2, β-catenin, and Lef1, it binds to promoter regions of genes regulating cell division (e.g., cyclin D1), pluripotency genes, and genes involved in EMT-associated processes .

A significant additional signaling mechanism involves EpEX functioning as a ligand for the epidermal growth factor receptor (EGFR). This interaction induces classical EGFR-mediated pathways, including AKT and Erk signaling, but with distinctive outcomes compared to EGF stimulation . For instance, in head and neck squamous cell carcinoma (HNSCC) cells, EpEX induces Erk1/2 activation to a lesser extent than EGF, resulting in mild cell proliferation without triggering EMT .

Role in Stemness and Proliferation

EpCAM plays critical roles in cellular proliferation and stemness maintenance. Through its RIP-mediated signaling, EpCAM activates the expression of genes involved in cell cycle progression, promoting cellular proliferation. Additionally, EpCAM regulates pluripotency genes, contributing to the maintenance of stem cell characteristics .

Recent research has revealed that EpEX binding to EGFR promotes the multipotency of mesenchymal stem cells by enhancing pluripotency factors. Mechanistically, this occurs through EGFR-dependent STAT3 activation and blockade of Let7 microRNA via upregulation of LIN28 . Consequently, EpEX induces proliferation of bone marrow-derived mesenchymal stem cells, further highlighting EpCAM's role in regulating stem cell fate through multiple mechanisms.

Physical and Chemical Properties

The physical and chemical properties of recombinant human EpCAM are summarized in the following table:

PropertyCharacteristic
Molecular WeightApproximately 40 kDa
Amino Acid SequenceTypically Gln24-Lys265 of human EpCAM
Additional TagsC-terminal 6-His tag
FormulationLyophilized from 0.2 μm filtered PBS solution
ReconstitutionRecommended at 500 μg/mL in PBS
Storage RecommendationsAvoid repeated freeze-thaw cycles; use manual defrost freezer
PurityGenerally >95%
Biological ActivityED50 of 0.4-2.4 μg/mL in cell adhesion assays

Research Applications

Recombinant human EpCAM serves as a valuable tool in fundamental research investigating molecular mechanisms of cell adhesion, proliferation, and signaling. It enables studies on EpCAM-mediated interactions with various molecular partners, including claudins, cadherins, and EGFR, advancing our understanding of epithelial biology and cancer progression.

Researchers utilize recombinant EpCAM in various experimental setups, including:

  • Cell adhesion assays to study EpCAM's role in intercellular interactions

  • Binding studies to identify and characterize EpCAM interaction partners

  • Competition assays to evaluate the efficacy of potential EpCAM-targeting therapeutics

  • Standard development for quantitative assays such as ELISA for EpCAM detection

Diagnostic Applications in Cancer

EpCAM's prominent expression in epithelial tumors has positioned it as a significant diagnostic marker. A particularly important diagnostic application involves the detection of circulating tumor cells (CTCs), where EpCAM serves as an anchor molecule for isolation and identification .

The CellSearch system, which relies on EpCAM-based enrichment, uses antibodies against EpCAM to isolate CTCs from peripheral blood of cancer patients . While this approach has proven valuable for prognosis and treatment monitoring, research indicates that some CTCs may downregulate EpCAM expression, particularly during epithelial-to-mesenchymal transition, potentially evading detection by EpCAM-based methods.

Studies have shown that combining EpCAM-dependent and EpCAM-independent detection methods can significantly improve the sensitivity of CTC detection. In metastatic lung cancer patients, the detection rate of CTCs increased from 15% to 41% when including EpCAM-negative CTCs that were missed by conventional EpCAM-based enrichment methods . This finding highlights the importance of comprehensive approaches to CTC detection for accurate cancer monitoring.

Therapeutic Applications

Recombinant EpCAM proteins are instrumental in developing targeted cancer therapeutics. These include:

  1. Immunotoxins: Researchers have developed constructs combining EpCAM-targeting antibody fragments with cytotoxic moieties. For example, an immunotoxin named APE, comprising an EpCAM single-chain variable fragment (scFv) and PE38KDEL (a modified form of Pseudomonas exotoxin), has demonstrated effective recognition of both recombinant and natural EpCAM and showed potent cytotoxicity against EpCAM-positive hepatocellular carcinoma cells .

  2. Monoclonal antibodies: Anti-EpCAM antibodies such as EpAb2-6 have shown promise in inhibiting nuclear translocation of EpICD and inducing apoptosis in cancer cells, potentially reducing metastasis formation .

  3. Cell-based therapies: EpCAM serves as a target antigen for engineered immune cell approaches, with ongoing research exploring these strategies for treating EpCAM-positive tumors.

The development of these therapeutic applications relies heavily on recombinant EpCAM proteins for initial validation, affinity testing, and preclinical evaluation.

Prognostic Value in Cancer

The presence and level of EpCAM expression have demonstrated prognostic significance in various cancer types. EpCAM serves as a marker for the epithelial status of primary and systemic tumor cells and is emerging as a measure for the metastatic capacity of CTCs .

Clinical studies have revealed interesting relationships between EpCAM expression and patient outcomes. For example, in head and neck squamous cell carcinoma (HNSCC), patients with EGFR-high/EpCAM-low expression profiles demonstrated very poor survival, whereas those with EGFR-low/EpCAM-high profiles had excellent clinical outcomes .

The prognostic significance of EpCAM expression in different cancer contexts is summarized in the following table:

Cancer TypeEpCAM Expression PatternClinical Correlation
HNSCCEGFR-high/EpCAM-lowPoor survival
HNSCCEGFR-low/EpCAM-highExcellent outcome
Colon carcinomaNuclear localization of EpICDAssociated with metastasis and worse outcome
Multiple carcinomasEpCAM+ CTCsPredictive of short survival
Metastatic lung cancerEpCAM+ CTCsAssociated with poor outcome
Metastatic lung cancerEpCAM- CTCsNo strong correlation with outcome in preliminary studies

It's important to note that the relationship between EpCAM expression and prognosis may vary depending on the cancer type and biological context . In some cases, EpCAM expression correlates with aggressive disease, while in others, it may indicate a more favorable prognosis.

Role in Tumor Heterogeneity and EMT

EpCAM contributes significantly to shaping intratumor heterogeneity and partial EMT, which are major determinants of the clinical outcome of carcinoma patients . As a marker for the epithelial status of tumor cells, EpCAM expression can reflect the phenotypic state of cancer cells along the epithelial-mesenchymal spectrum.

During EMT, cancer cells typically downregulate epithelial markers, including EpCAM, and upregulate mesenchymal markers, enhancing their migratory and invasive capabilities. This transition is particularly relevant in the context of CTCs, where EpCAM-negative cells may represent a more mesenchymal, potentially more aggressive subpopulation .

Understanding the dynamic regulation of EpCAM during tumor progression and metastasis formation provides valuable insights into the mechanisms of cancer dissemination and may inform the development of more effective diagnostic and therapeutic strategies.

Advances in CTC Detection Technologies

Current research is addressing the limitations of purely EpCAM-based approaches to CTC detection. Studies comparing capture methods have demonstrated that CellSearch efficiently recovers cells with high EpCAM expression, but cells with low or no EpCAM expression are significantly less efficiently captured . Alternative approaches, such as filtration-based methods, can complement EpCAM-based enrichment by capturing EpCAM-negative CTCs based on physical properties like cell size .

In a validation study using different cell lines spiked into blood, researchers found that the majority of EpCAM-high cells could be detected with CellSearch, whereas most cells with EpCAM-low or EpCAM-negative expression were detected using filtration . This complementary approach significantly improves the comprehensive detection of CTCs with varying EpCAM expression levels.

Development of Novel Immunotoxins

The development of EpCAM-targeting immunotoxins represents an active area of research with promising therapeutic potential. Studies have demonstrated that constructs combining EpCAM-specific antibody fragments with cytotoxic moieties can effectively recognize EpCAM on cancer cells and induce potent cytotoxicity .

For example, researchers have prepared and evaluated seven EpCAM immunotoxins composed of an anti-EpCAM single-chain variable fragment (scFv) and PE38KDEL (a modified form of Pseudomonas exotoxin) . These constructs showed effective binding to recombinant and natural EpCAM, though with relatively lower antigen-binding activity compared to the parental antibody . MTT assays confirmed that these immunotoxins could potently reduce the viability of EpCAM-positive human hepatocellular carcinoma (HHCC) cells, demonstrating their potential as targeted therapeutic agents .

Future Research Directions

Several promising directions for future investigation in EpCAM research include:

  1. Molecular characterization: Further studies are needed to elucidate the differences between EpCAM-positive and EpCAM-negative CTCs, particularly regarding their metastatic potential and clinical significance . This characterization will enhance our understanding of tumor heterogeneity and its implications for cancer progression.

  2. Regulatory mechanisms: Deeper investigation into the factors that regulate EpCAM expression, processing, and signaling, especially during processes like EMT, may reveal new therapeutic targets and diagnostic approaches.

  3. Combination therapies: Exploring the synergistic potential of EpCAM-targeted therapies with other treatment modalities represents an important area for clinical investigation.

  4. Advanced detection methods: Developing more sensitive and comprehensive approaches to detect the full spectrum of CTCs, regardless of their EpCAM expression status, will improve cancer monitoring and personalized treatment strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order remarks section, and we will strive to fulfill your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your reconstitution.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
17 1A; 323/A3; Adenocarcinoma associated antigen; Adenocarcinoma-associated antigen; Antigen identified by monoclonal AUA1; AUA1; CD326; CD326 antigen; Cell surface glycoprotein Trop 1; Cell surface glycoprotein Trop 2; Cell surface glycoprotein Trop-1; CO 17A; CO17 1A; CO17A; DIAR5; EGP 2; EGP; EGP2; EGP314; EGP40; Ep CAM; Ep-CAM; EPCAM; EPCAM_HUMAN; EpCAM1; Epithelial cell adhesion molecule; Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD); Epithelial cell surface antigen; Epithelial cellular adhesion molecule; Epithelial glycoprotein 1; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733 1; GA733 2; GA733-2; gastrointestinal tumor-associated antigen 2; 35-KD glycoprotein; gp4; hEGP 2; hEGP314; HNPCC8; Human epithelial glycoprotein 2; KS 1/4 antigen; KS1/4; KSA; Ly74; Lymphocyte antigen 74; M1S 1; M1S2; M4S1; Major gastrointestinal tumor associated protein GA733 2; Major gastrointestinal tumor-associated protein GA733-2; mEGP314; Membrane component chromosome 4 surface marker (35kD glycoprotein); Membrane component; chromosome 4; surface marker 1; Membrane component; chromosome 4; surface marker; MIC18; MK 1; Protein 289A; TACD1; TACSTD1; TROP1; Tumor associated calcium signal transducer 1; Tumor associated calcium signal transducer 2 precursor; Tumor-associated calcium signal transducer 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-314
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Uniprot No.

Target Background

Function
Epithelial cell adhesion molecule (EPCAM) acts as a homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium, contributing to the immunological barrier and providing a first line of defense against mucosal infection. It also plays a role in embryonic stem cell proliferation and differentiation, upregulating the expression of FABP5, MYC, and cyclins A and E.
Gene References Into Functions
  1. This research presented a novel approach for CTC detection in NSCLC using a combination of EpCAM and FRalpha, enhancing sensitivity, specificity, and efficiency. PMID: 29352248
  2. This review explores the multifaceted functions of EpCAM in physiological processes and diseases. PMID: 30015855
  3. Our findings suggest that GA733-2-Fc conjugated to ER-retention motif KDEL is a more effective antigen for preventing colorectal carcinoma-induced tumor growth and minimizing allergic responses. PMID: 30249898
  4. Extracellular vesicles tend to localize in the intestinal tract, specifically associating with epithelial cell adhesion molecule. PMID: 27721471
  5. Overexpression of EpCAM and melan-A is linked to malignant melanoma. PMID: 29076925
  6. Quercetin has been shown to suppress breast cancer stem cell proliferation, self-renewal, and invasiveness. It also downregulates the expression of proteins involved in tumorigenesis and cancer progression, such as aldehyde dehydrogenase 1A1, C-X-C chemokine receptor type 4, mucin 1, and epithelial cell adhesion molecules. PMID: 29353288
  7. Adenocarcinomas displayed significantly higher staining scores for both VEGF and alphaSMA compared to squamous cell carcinomas. In cases with high CD31 scores, patients with lung cancer exhibiting mature tumor vessels demonstrated a significantly better five-year survival rate (87%) than those with immature tumor vessels (69%). PMID: 29970536
  8. A new EPCAM founder deletion associated with Lynch Syndrome has been described in the Polish population. PMID: 28369810
  9. This review provides novel and updated insights into the EpCAM field, simplifying the understanding of its biological role and highlighting promising therapeutic tools developed through various approaches using antibodies and vaccines for different cancer types. These advancements aim to improve patient outcomes. PMID: 29759567
  10. This study is the first to demonstrate that the low sensitivity of CellSearch(R) in detecting circulating tumor cells in colorectal cancer patients is not due to the lack of EpCAM. PMID: 28604994
  11. The data suggest that epithelial cell adhesion molecule (EpCAM) can be utilized as an additional marker for distinguishing cystic lesions in the sellar region. PMID: 27431859
  12. Data indicate that epithelial cell adhesion molecule (EpCAM) exhibits high tumor distinctiveness. PMID: 28820475
  13. Low expressions of Oct4-EpCAM in IHC and CD133 in qPCR may reveal roles in gastric cancer. PMID: 27557490
  14. EpCAM expression contributes to tumor resistance to chemotherapy in patients with ovarian cancer. PMID: 28574829
  15. The current findings suggest that Ep-CAM expression may be associated with CRC carcinogenesis, while the loss of Ep-CAM expression is correlated with the progression, metastasis, and poor prognosis of CRC. Ep-CAM expression could potentially serve as a valuable biomarker for the clinical diagnosis of CRC. PMID: 28558958
  16. The present study identified a positive correlation between EpCAM and COX-2 expression in breast cancer cell lines and tissue specimens. Both EpCAM and COX-2 were associated with the prognosis of breast cancer patients. PMID: 28393249
  17. CD133+ cells exhibited genetic heterogeneity among patients, lacking a defined profile compared to CD133-/EpCAM+ cells. PMID: 28347289
  18. Combining the targets E-cadherin, epithelial membrane antigen (EMA), human epidermal growth receptor type 2 (Her2/neu), and carcinoembryonic antigen (CEA) resulted in nearly 100% detection of ductal ovarian metastases. The combination of EMA, Her2/neu, and epithelial cell adhesion molecule (EpCAM) proved most suitable for detecting lobular ovarian metastases. PMID: 28327103
  19. Whole-genome sequencing identified the homozygous intronic variant EPCAM c.556-14A>G, considered explanatory for the patient's intractable diarrhea and providing a diagnosis of congenital tufting enteropathy. PMID: 28701297
  20. Low EPCAM expression is associated with colorectal carcinoma. PMID: 26528695
  21. Our study provided clinical evidence for EpCAM intracellular domain as a predictor of cancer development in patients with oral dysplasia and recurrence in oral squamous cell carcinoma patients. PMID: 27421772
  22. Elevated epithelial cell adhesion molecule EpCAM (mRNA+) CTC and Treg/CD4(+) levels were associated with early recurrence of hepatocellular carcinoma (HCC), indicating a poor clinical outcome. PMID: 27439521
  23. Observations provide crucial insights into the regulation of EpCAM expression during EMT, demonstrating an unexpected role for EpCAM in regulating ERK. This research defines a novel double-negative feedback loop between EpCAM and ERK that contributes to the regulation of EMT. PMID: 28192403
  24. This study highlights the potential of an EpCAM-specific NIR-fluorescent agent in conjunction with a clinically validated intraoperative imaging system to visualize various tumors during surgery. PMID: 27842504
  25. The studies identified the characteristics and function of EpCAM glycosylation sites on breast cancer cell adhesion. PMID: 28315854
  26. These findings identify EpCAM as a substrate of matriptase and connect HAI-2, matriptase, EpCAM, and claudin-7 in a functionally significant pathway that leads to disease when dysregulated. PMID: 28094766
  27. The EpCAM aptamer conjugated NCS demonstrated specificity towards EpCAM-positive cells. PMID: 28668853
  28. Pseudomyxoma peritonei ubiquitously expresses CEA and EpCAM. PMID: 27038681
  29. The study investigates the relationship between EpCAM-regulated transcription and altered biophysical properties of cells that promote epithelial-mesenchymal transition (EMT) in advanced endometrial cancer. PMID: 27569206
  30. Utilizing a next-generation sequencing (NGS) approach, the study revealed that NY-SAR-35 expression induced growth, proliferation, metastasis, and stemness genes, as indicated by the upregulation of CXCR4, EpCAM, CD133, and CD44, at both the mRNA and protein levels. PMID: 28126340
  31. These results indicate that adipocyte-secreted factors might regulate cancer stem cell behavior through various signaling molecules, including c-Met, STAT3, and ERK1/2. Inhibiting these signaling pathways offers novel strategies for targeting the effects of adipose-derived cytokines in cancer. PMID: 27131739
  32. The meta-analysis demonstrated that the expression of EpCAM in the gastric cancer group was greater than that in the control group. Moreover, EpCAM overexpression was associated with larger tumor size, lymph node metastasis, and worse prognosis in gastric cancer. [review] PMID: 28403178
  33. Expression of EpCAM(MT) is associated with a more aggressive phenotype and predicts poor survival in patients with colorectal cancer. PMID: 26996277
  34. Higher levels of epithelial cell adhesion molecule (EpCAM) in breast cancer may be linked to poor response to Neoadjuvant chemotherapy (NAC) through a potential chemoresistant effect. PMID: 27041736
  35. By monitoring fluorescence signal changes, the target EpCAM protein could be detected sensitively and selectively with a linear detection range from 3 nM to 54 nM and a limit of detection (LOD) around 450 pM. This nanobiosensor has been successfully utilized for detecting EpCAM-expressed breast cancer MCF-7 cells. PMID: 27614683
  36. EpCAM, CD44, and CD133 expression could serve as candidate markers for Barrett esophagus disease progression. PMID: 28216140
  37. These findings provide valuable insights into the regulation of epithelial cell adhesion molecule apoptosis and suggest epithelial cell adhesion molecule as a potential target for breast cancer treatment. PMID: 28349835
  38. The study revealed a distinct expression pattern of epithelial cell adhesion molecule among salivary gland neoplasms and in different grades of mucoepidermoid carcinomas. PMID: 27649957
  39. We concluded that the peptide could serve as a valuable supplement to the EpCAM antibody for capturing Circulating tumor cells (CTCs) in microfluidic systems, expanding the detection spectrum. PMID: 27818051
  40. This study presents a molecular characterization of congenital tufting enteropathy in Italian patients and identifies three mutations in the EpCAM gene. PMID: 26684320
  41. EpCAM serves as a potential prognostic biomarker that could be used to identify oral squamous cell carcinoma patients at high risk and predict patient survival. PMID: 26401964
  42. Findings indicate that the EGF-like domain of EpCAM is cleaved off in cancer cells that have undergone epithelial-mesenchymal transition. PMID: 26775583
  43. Based on these results, it can be concluded that EpCAM is suitable for use as an EC biomarker, therapeutic target, and an effective parameter for tumor transfer and prognosis evaluation using aptamer SYL3C staining. PMID: 26687301
  44. CHD4 was abundantly expressed in EpCAM(+) hepatocellular carcinoma with the expression of hepatic stem cell markers and poor prognosis in two independent cohorts. PMID: 26095183
  45. Flow cytometry assay showed that doxorubicin exposure decreased EpCAM-positive cell quantities in three HCC cell lines. EpCAM siRNA knock-down attenuated cell mortality following doxorubicin exposure. PMID: 26984381
  46. EpCAM-based capture effectively detects and recovers circulating tumor cells from all subtypes of breast cancer except those with low claudin expression. PMID: 26556851
  47. Increased expression of EPCAM mRNA is associated with recurrence after curative resection of hepatocellular carcinoma. PMID: 25791790
  48. We unveiled a new molecular mechanism of MTA1-mediated invasion and metastasis in lung cancer through downstream target EpCAM. Interfering with EpCAM function may represent a novel therapeutic strategy for treating MTA1-overexpressing lung carcinoma. PMID: 26698569
  49. Knockdown of EpCAM can inhibit breast cancer cell growth and metastasis by suppressing the Ras/Raf/ERK signaling pathway and MMP-9. PMID: 26356670
  50. Results suggest that the anti-epithelial cell adhesion molecule (EpCAM) monoclonal antibody holds potential for cancer-targeted therapy. PMID: 26317650

Show More

Hide All

Database Links

HGNC: 11529

OMIM: 185535

KEGG: hsa:4072

STRING: 9606.ENSP00000263735

UniGene: Hs.542050

Involvement In Disease
Diarrhea 5, with tufting enteropathy, congenital (DIAR5); Hereditary non-polyposis colorectal cancer 8 (HNPCC8)
Protein Families
EPCAM family
Subcellular Location
Lateral cell membrane; Single-pass type I membrane protein. Cell junction, tight junction.
Tissue Specificity
Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal

Q&A

What is the molecular structure of human EpCAM?

Human EpCAM is a 40 kDa transmembrane glycoprotein with a complex structure comprising three distinct domains. X-ray crystallography at 1.86 Å resolution reveals that the extracellular domain (EpEX) has a three-partite organization consisting of:

  • Amino-terminal domain (puroGlu24–Leu62)

  • Thyroglobulin-like domain (Ala63–Arg138)

  • Carboxy-terminal domain (Val139–Lys265)

These domains interact to form a triangular structure, with each domain contacting the other two. The recombinant protein typically includes amino acids Gln24-Lys265 with a C-terminal His-tag for purification purposes .

EpCAM molecules form cis-dimers with the strongest interactions occurring between the thyroglobulin loop of one molecule and the βC sheet of a second molecule. Coarse grain modeling suggests that the transmembrane domain forms dimeric structures where two helices cross between Val276 and Val280. The complete intracellular domain structure (EpICD) remains undetermined .

What are the primary functions of EpCAM in normal cellular physiology?

EpCAM serves multiple physiological functions that have been elucidated through various experimental approaches:

  • Cell Adhesion Regulation: EpCAM was initially characterized as a homophilic cell adhesion molecule, promoting intercellular adhesion and cell aggregation in suspension. Membrane-proximal thyroglobulin-like domains mediate lateral interactions in cis, while membrane-distal EGF-like repeats facilitate trans interactions between adjacent cells .

  • Epithelial Integrity: EpCAM plays a crucial role in maintaining epithelial tissue integrity, often working in concert with other adhesion molecules like claudins and cadherins .

  • Proliferation and Differentiation Control: EpCAM regulates proliferation and differentiation in keratinocytes, transformed epithelial cells, and carcinoma cell lines. It also influences pluripotent embryonic stem cells (ESCs), progenitor cells, and carcinoma stem cells .

  • Cell Migration and Invasion Modulation: Research demonstrates EpCAM's involvement in regulating cell migration and invasion processes, suggesting its role in tissue remodeling .

Interestingly, while promoting adhesion in some contexts, EpCAM can also reduce cadherin-mediated adhesion by disrupting E-cadherin, α-catenin, and F-actin interactions, indicating context-dependent functionality .

How is recombinant human EpCAM typically produced and validated for research use?

Recombinant human EpCAM production typically follows these methodological steps:

  • Expression System Selection: Commonly expressed in mammalian expression systems to ensure proper glycosylation and folding.

  • Construct Design: DNA constructs typically encode amino acids Gln24-Lys265 (the extracellular domain) with a C-terminal His-tag to facilitate purification .

  • Purification Process: Affinity chromatography using the His-tag, followed by size exclusion chromatography.

  • Quality Control Measurements:

    • SDS-PAGE analysis to confirm >95% purity

    • SEC-HPLC to verify homogeneity and absence of aggregation

    • Functional validation through cell adhesion assays

  • Formulation: Typically lyophilized from a 0.2 μm filtered solution in PBS, requiring reconstitution at approximately 500 μg/mL in PBS before use .

Validation Assays:

  • ELISA: Immobilized recombinant EpCAM is tested with anti-Trop1 antibodies, generating dose-response curves to confirm proper folding and epitope presentation. Typical EC50 values range from 5-10 ng/mL .

  • Functional Adhesion Assays: When mouse fibroblast L cells are added to plates coated with recombinant human EpCAM in combination with human fibronectin (0.5 μg/mL), cell adhesion is enhanced in a dose-dependent manner with ED50 values of 0.4-2.4 μg/mL .

What is the optimal protocol for using recombinant EpCAM in cell adhesion assays?

When designing cell adhesion experiments with recombinant human EpCAM, researchers should follow this methodological approach:

  • Surface Preparation:

    • Coat culture plates with a combination of recombinant human EpCAM (1-10 μg/mL) and human fibronectin (0.5 μg/mL)

    • Incubate overnight at 4°C

    • Block non-specific binding sites with 1% BSA in PBS for 1 hour at room temperature

    • Wash three times with PBS before adding cells

  • Cell Preparation:

    • For optimal results, use cell lines known to respond to EpCAM-mediated adhesion (e.g., L cells mouse fibroblasts)

    • Harvest cells using enzyme-free dissociation buffer to preserve surface proteins

    • Resuspend cells in serum-free medium at a density of 1-5×104 cells/well

  • Assay Conditions:

    • Include appropriate controls (fibronectin-only, BSA-only)

    • Test a dose range of EpCAM (typically 0.1-10 μg/mL)

    • Allow adhesion to occur for 30-60 minutes at 37°C

    • Carefully wash non-adherent cells and quantify adhesion

  • Quantification Methods:

    • Crystal violet staining followed by solubilization and absorbance measurement

    • Fluorescent labeling of cells prior to the assay

    • Direct microscopic counting of adherent cells

This approach typically yields dose-dependent enhancement of cell adhesion with ED50 values in the range of 0.4-2.4 μg/mL when EpCAM is combined with fibronectin .

How should EpCAM expression be quantified in tissue samples for research purposes?

Quantification of EpCAM expression in tissue samples requires standardized methodology to ensure reproducibility and comparability across studies:

  • Immunohistochemical (IHC) Semi-quantitative Assessment:

    • Create tissue microarrays (TMAs) from formalin-fixed paraffin-embedded tissues

    • Use validated anti-EpCAM antibodies (specify clone for reproducibility)

    • Implement a scoring system combining staining proportion and intensity:

      • Proportion score (PS): 0 (0%), 1 (1-10%), 2 (11-50%), 3 (51-80%), 4 (>80%)

      • Intensity score (IS): 0 (none), 1 (weak), 2 (moderate), 3 (strong)

      • Total immunostaining score (TIS) = PS × IS (range: 0-12)

    • Categorize expression levels: negative/weak (0-2), moderate (3, 4, 6), strong (8, 9, 12)

    • Define overexpression as TIS > 4

  • Flow Cytometry Quantification:

    • Single-cell suspensions from fresh tissue or cultured cells

    • Use fluorescently labeled anti-EpCAM antibodies

    • Quantify mean fluorescence intensity (MFI)

    • Calculate molecules of equivalent soluble fluorochrome (MESF) for absolute quantification

  • Western Blot Analysis:

    • Extract proteins with detergent-containing buffers

    • Separate proteins by SDS-PAGE and transfer to membranes

    • Detect EpCAM with specific antibodies

    • Use densitometry normalized to housekeeping proteins for semi-quantitative analysis

  • qRT-PCR for mRNA Expression:

    • Extract total RNA from tissues

    • Perform reverse transcription

    • Quantify EpCAM mRNA levels relative to reference genes

    • Correlate with protein expression to identify post-transcriptional regulation

Statistical analysis should include appropriate tests for comparing expression between samples (e.g., Chi-square, t-test) with significance set at p ≤ 0.05 .

What controls should be included when studying EpCAM in cancer research models?

Comprehensive cancer research involving EpCAM requires rigorous control selection to ensure valid interpretations:

  • Tissue Controls:

    • Positive tissue controls: Include known EpCAM-positive epithelial tissues (colon epithelium, breast epithelium)

    • Negative tissue controls: Include EpCAM-negative tissues (lymphoid tissue, stromal components)

    • Matched non-cancer tissue: Always compare tumor samples with matching normal epithelial tissue from the same patient

  • Cell Line Controls:

    • High EpCAM-expressing cell lines: HT-29, MCF-7 (serve as positive controls)

    • Low/negative EpCAM-expressing cell lines: Mesenchymal or stromal cell lines

    • Engineered cell lines: Use isogenic cell lines with inducible EpCAM expression systems to control EpCAM levels precisely

  • Experimental Controls:

    • Antibody controls: Include isotype controls for immunostaining

    • Functional redundancy controls: Examine other adhesion molecules (E-cadherin, claudins) alongside EpCAM to account for compensatory mechanisms

    • Genetic controls: Include EPCAM knockout/knockdown models and rescue experiments

    • Technical replicates: Perform experiments at least in triplicate to ensure reproducibility

  • Clinical Controls:

    • Patient-matched samples: Analyze primary tumor, metastatic sites, and normal tissue from the same patient

    • Stage-matched cohorts: Compare patients at similar disease stages

    • Treatment-naive vs. treated samples: Account for therapy effects on EpCAM expression

These controls are essential for distinguishing EpCAM-specific effects from background phenomena and for resolving contradictory findings that appear in the literature.

How does EpCAM modulate cadherin-mediated cell adhesion at the molecular level?

The mechanism by which EpCAM modulates cadherin-mediated adhesion involves complex molecular interactions that can be experimentally dissected:

This molecular mechanism suggests that EpCAM may contribute to the development of proliferative and potentially malignant phenotypes in epithelial cells by modulating traditional adhesion complexes .

What are the key experimental considerations when studying EpCAM's role in epithelial-to-mesenchymal transition (EMT)?

Investigating EpCAM's complex role in EMT requires sophisticated experimental approaches:

  • Dynamic Expression Analysis:

    • Monitor EpCAM levels throughout the EMT process using time-course experiments

    • Correlate EpCAM expression changes with established EMT markers (E-cadherin, vimentin, Snail, Zeb1)

    • Use live-cell imaging with fluorescently tagged EpCAM to track subcellular localization during EMT

  • Functional Assessments:

    • Perform gain and loss of function experiments (inducible expression systems, CRISPR/Cas9 knockout)

    • Assess changes in:

      • Cell morphology (epithelial vs. mesenchymal features)

      • Migration and invasion capabilities

      • Expression of EMT master regulators

      • Cell-cell and cell-matrix adhesion properties

  • Signaling Pathway Integration:

    • Examine crosstalk with known EMT-inducing pathways (TGF-β, WNT, Notch)

    • Investigate interactions between EpCAM and other EMT regulators

    • Study how EpCAM proteolysis contributes to EMT signaling

  • Experimental Models Selection:

    • 2D vs. 3D culture systems: 3D models better recapitulate in vivo EMT dynamics

    • Cell line selection: Use epithelial cell lines known to undergo EMT (A549, MCF-7)

    • Primary cell cultures: Validate findings in patient-derived cells

    • In vivo models: Confirm in vitro observations using xenograft or transgenic models

  • Resolving Contradictory Observations:

    • EpCAM is traditionally considered an epithelial marker, yet some research suggests roles in promoting EMT

    • Investigate context-dependent functions through microenvironment manipulation

    • Examine differences between partial and complete EMT states

    • Consider post-translational modifications and proteolytic processing that might explain dual roles

These methodological considerations help resolve the apparent paradox of EpCAM's role in maintaining epithelial identity while also potentially promoting EMT in specific contexts.

How can researchers address the heterogeneity of EpCAM expression in circulating tumor cells (CTCs)?

Addressing heterogeneous EpCAM expression in CTCs requires sophisticated methodological approaches:

  • Multi-Parameter CTC Isolation Strategies:

    • Combine EpCAM-based and EpCAM-independent isolation methods:

      • Traditional EpCAM-based enrichment (e.g., CellSearch)

      • Size-based filtration

      • Density gradient separation

      • Microfluidic approaches capturing cells based on multiple properties

    • Implement negative selection to remove leukocytes (CD45 depletion) before applying epithelial markers

  • Single-Cell Analysis Techniques:

    • Apply single-cell RNA sequencing to CTCs to identify distinct subpopulations

    • Perform multi-parameter flow cytometry with expanded marker panels

    • Use mass cytometry (CyTOF) for high-dimensional analysis of protein expression

    • Correlate EpCAM expression with stemness markers, EMT status, and proliferation markers

  • Functional Characterization:

    • Isolate EpCAM-high vs. EpCAM-low/negative CTCs and compare:

      • Tumorigenic potential in xenograft models

      • Migratory and invasive properties

      • Drug sensitivity profiles

      • Metastatic efficiency

  • Longitudinal Monitoring:

    • Track changes in EpCAM expression during disease progression

    • Assess shifts in CTC phenotypes in response to therapy

    • Correlate dynamic EpCAM patterns with clinical outcomes

  • Technical Considerations for Research Design:

    • Optimize sample processing times to minimize artifacts

    • Standardize fixation and staining protocols to preserve EpCAM epitopes

    • Include spike-in controls with known EpCAM expression levels

    • Implement digital pathology approaches for quantitative assessment of expression

    • Use multi-regional sampling to account for intratumoral heterogeneity

This comprehensive approach allows researchers to better understand the biological significance of heterogeneous EpCAM expression in CTCs and its implications for metastasis and therapeutic response.

What experimental approaches can resolve contradictory findings regarding EpCAM's adhesive functions?

Resolving contradictions in EpCAM's adhesive functions requires systematic experimental approaches:

  • Context-Dependent Analysis:

    • Cell type specificity: Compare adhesive functions across multiple epithelial, mesenchymal, and cancer cell types

    • Expression level dependence: Use inducible expression systems to precisely control EpCAM levels

    • Microenvironmental factors: Examine how matrix composition and soluble factors modify EpCAM function

  • Detailed Molecular Interaction Studies:

    • Structure-function analysis: Create domain-specific mutants to identify regions required for different functions

    • Interactome mapping: Use proximity labeling (BioID, APEX) to identify EpCAM binding partners in different contexts

    • Proteolytic processing: Examine how regulated intramembrane proteolysis affects adhesive vs. signaling functions

  • Advanced Biophysical Techniques:

    • Atomic force microscopy: Directly measure cell-cell adhesion forces with and without EpCAM

    • FRET/FLIM analysis: Detect molecular interactions between EpCAM and cadherin complex proteins

    • Super-resolution microscopy: Visualize nanoscale organization of adhesion complexes

  • Integrated Multi-omics Approach:

    • Temporal transcriptomics/proteomics: Capture dynamic changes following EpCAM modulation

    • Phosphoproteomics: Identify signaling changes affecting adhesion complexes

    • Correlation analysis: Integrate datasets to distinguish direct vs. indirect effects

  • Experimental Design Recommendations:

    • Control for EpCAM's dual roles in adhesion vs. signaling

    • Recognize that some contradictions stem from using different experimental models

    • Distinguish homophilic binding from EpCAM's effects on other adhesion systems

    • Consider compensatory mechanisms that may mask phenotypes in knockout models

Such systematic approaches could help reconcile observations where EpCAM promotes adhesion in some contexts (fibroblasts, cancer cells in suspension) while disrupting cadherin-based adherens junctions in others (epithelial monolayers) .

What are the optimal parameters for using recombinant EpCAM in CTC enrichment protocols?

When developing CTC enrichment protocols using recombinant EpCAM, researchers should optimize these key parameters:

  • Antibody Selection and Coating Strategy:

    • Antibody affinity: Select anti-EpCAM antibodies with Kd values in the 1-10 nM range

    • Epitope selection: Target the N-terminal domain (amino acids 24-62) which shows highest accessibility

    • Coating density: Optimize surface density between 1-5 μg/cm² on capture surfaces

    • Orientation control: Use streptavidin-biotin or His-tag systems for oriented antibody immobilization

  • Sample Processing Parameters:

    • Flow rate optimization: Balance between capture efficiency and throughput (typically 1-2 mL/hour for microfluidic systems)

    • Sample preparation: Minimize pre-analytical variables by standardizing:

      • Blood collection tubes (EDTA vs. CellSave)

      • Processing time (<4 hours from collection)

      • Red blood cell lysis conditions

      • Buffer composition and pH (7.2-7.4)

  • Technical Validation Metrics:

    • Recovery rate: Validate with spike-in experiments using cell lines with known EpCAM expression levels

    • Purity assessment: Quantify contaminating leukocytes in enriched fractions

    • Reproducibility: Establish coefficient of variation across replicates (<15%)

    • Limit of detection: Determine minimum detectable CTC concentration

  • Analytical Considerations:

    • Define positivity criteria: Implement standardized scoring for EpCAM staining intensity

    • Multiplexing strategy: Combine EpCAM with additional markers (cytokeratins, CD45, DAPI)

    • Image analysis parameters: Standardize cell size, shape, and intensity thresholds

    • Quality control: Include positive and negative controls in each experimental run

These optimized parameters ensure reproducible CTC enrichment while accounting for the heterogeneous expression of EpCAM in clinical samples.

How can researchers effectively study EpCAM's intracellular signaling domains?

Investigating EpCAM's intracellular signaling domains requires specialized experimental approaches:

  • Domain-Specific Analysis Tools:

    • Deletion mutants: Generate truncated forms lacking specific intracellular regions

    • Point mutations: Target specific amino acids involved in signaling interactions

    • Domain swapping: Replace EpCAM's intracellular domain with those from related proteins

    • Split protein complementation: Study interaction dynamics in living cells

  • Proteolytic Processing Examination:

    • Regulated intramembrane proteolysis monitoring: Track generation of EpEX and EpICD

    • Protease inhibitor studies: Use specific inhibitors of ADAM17 and presenilin-2 to block sequential cleavage

    • Site-directed mutagenesis: Modify cleavage sites to create non-cleavable variants

    • Fluorescent reporters: Develop systems to visualize real-time proteolytic processing

  • Interaction Partner Identification:

    • Co-immunoprecipitation: Identify binding partners of full-length EpCAM vs. EpICD

    • Yeast two-hybrid screening: Discover novel interactors of the intracellular domain

    • Proximity labeling: Use BioID or APEX2 fusions to identify neighboring proteins

    • Cross-linking mass spectrometry: Map interaction surfaces at amino acid resolution

  • Signaling Pathway Integration:

    • Nuclear translocation assays: Track EpICD movement to the nucleus

    • Transcriptional reporter assays: Measure activation of downstream targets

    • Phosphorylation analysis: Identify modifications regulating activity

    • Pathway inhibitor studies: Determine dependency on WNT and Ras/Raf signaling

These approaches can help resolve how EpICD contributes to EpCAM's diverse cellular functions, particularly in proliferation, stemness, and cancer progression contexts.

What methodological approaches can differentiate between EpCAM's roles in normal epithelia versus cancer tissues?

To distinguish EpCAM's differential roles in normal versus malignant contexts, researchers should implement:

  • Comparative Expression Analysis:

    • Paired normal-tumor tissue analysis: Directly compare matched samples from the same patient

    • Developmental timeline mapping: Examine expression during embryogenesis, adult homeostasis, and cancer progression

    • Cellular heterogeneity assessment: Use single-cell approaches to identify cell-type specific patterns

    • Subcellular localization comparison: Evaluate differences in membrane vs. cytoplasmic vs. nuclear distribution

  • Functional Impact Differentiation:

    • Tissue-specific genetic models: Generate conditional knockouts in normal epithelia vs. tumors

    • 3D organoid systems: Compare EpCAM function in normal and tumor-derived organoids

    • Ex vivo tissue slice cultures: Maintain architecture while manipulating EpCAM

    • Inducible systems: Control timing and level of expression in different contexts

  • Molecular Interaction Comparison:

    • Context-specific interactome analysis: Identify differential binding partners

    • Post-translational modification profiling: Map glycosylation, phosphorylation patterns

    • Proteolytic processing efficiency: Compare EpCAM cleavage rates and fragment functions

    • Membrane microdomain localization: Assess lipid raft association differences

  • Technical Approach Considerations:

    • Use tissue microarrays containing multiple tumor types alongside normal controls

    • Implement standardized scoring systems like TIS (Total Immunostaining Score)

    • Account for tumor heterogeneity through multi-regional sampling

    • Control for microenvironmental factors (inflammation, hypoxia) that may alter expression

    • Design experiments to distinguish prognostic value from causative role

These methodological approaches can help resolve the apparent paradox of EpCAM's role in normal tissue maintenance versus its contribution to carcinogenesis and metastasis.

How should researchers resolve discrepancies in EpCAM's reported adhesive functions?

Addressing contradictory findings regarding EpCAM's adhesive properties requires systematic investigation:

  • Systematic Review of Experimental Conditions:

    • Cell type dependencies: Compare findings across:

      • Fibroblasts (where EpCAM promotes adhesion)

      • Epithelial cells (where EpCAM can disrupt cadherin-based adhesion)

      • Cancer cells of different origins

    • Expression level effects: Determine if contradictions stem from concentration-dependent effects

    • Assay-specific influences: Compare suspension aggregation vs. adherent monolayer studies

  • Reconciliation Framework:

    • EpCAM appears to promote homophilic adhesion when expressed in cells lacking other adhesion systems (fibroblasts)

    • In epithelial cells with established cadherin-based junctions, EpCAM can disrupt these connections by:

      • Decreasing the detergent-insoluble fraction of cadherins (cytoskeleton association)

      • Reducing total cellular α-catenin levels

      • Activating PI3K-dependent signaling that interferes with adherens junctions

    • The cytoplasmic domain is essential for this disruptive effect, as adhesion-defective EpCAM mutants lacking this domain have no effect on cadherin function

  • Multifunctional Model Development:

    • Develop models that account for:

      • Direct adhesive functions (homophilic binding)

      • Indirect effects on other adhesion systems

      • Signaling-dependent adhesion modulation

      • Context-dependent outcomes

  • Standardized Testing Methodology:

    • Implement consistent protocols across laboratories

    • Use standardized cell lines and expression systems

    • Develop quantitative adhesion measurement techniques

    • Control for experimental variables that may influence outcomes

This systematic approach can help reconcile observations where EpCAM has been reported to both promote cell aggregation in suspension and disrupt adherens junctions in epithelial monolayers.

What statistical approaches are most appropriate for analyzing heterogeneous EpCAM expression in cancer samples?

When analyzing heterogeneous EpCAM expression in cancer tissues, these statistical approaches are recommended:

These statistical approaches facilitate robust analysis of heterogeneous EpCAM expression while minimizing spurious associations and maximizing reproducibility across studies.

How can researchers interpret contradictory prognostic associations of EpCAM expression across different cancer types?

Resolving contradictory prognostic associations requires sophisticated analytical approaches:

  • Cancer-Type Specific Analysis Framework:

    • Stratified meta-analysis: Analyze prognostic impact separately by cancer type, stage, and molecular subtype

    • Context-dependent hypothesis testing: Consider that EpCAM may have different roles depending on cellular origin

    • Baseline expression calibration: Account for normal tissue expression levels when interpreting cancer expression

    • Functional context integration: Connect expression patterns to known cancer biology

  • Multidimensional Expression Assessment:

    • Beyond simple high/low categorization: Implement:

      • Continuous expression analysis

      • Dynamic range consideration

      • Heterogeneity quantification

      • Subcellular localization assessment

    • Proteolytic processing analysis: Distinguish between full-length EpCAM and its cleaved fragments (EpEX vs. EpICD)

    • Co-expression patterns: Evaluate interactions with other markers (E-cadherin, stemness markers)

  • Methodological Standardization:

    • Detection method harmonization: Compare IHC, flow cytometry, and molecular techniques

    • Antibody clone standardization: Different epitopes may yield varying results

    • Scoring system unification: Apply consistent thresholds for positivity

    • Reproducibility assessment: Report inter-observer and inter-laboratory concordance

  • Advanced Analytical Approaches:

    • Time-dependent coefficient modeling: Allow for varying effects across disease course

    • Competing risk analysis: Account for non-cancer deaths and other competing outcomes

    • Propensity score methods: Adjust for selection bias in observational studies

    • Causal inference techniques: Distinguish prognostic from predictive biomarker value

  • Biological Interpretation Framework:

    • EpCAM may serve different functions depending on cancer context:

      • In some epithelial cancers, high expression may indicate well-differentiated status

      • In contexts of metastasis, EpCAM can facilitate CTC survival and colonization

      • During EMT, dynamic regulation rather than absolute levels may be most informative

      • The balance between adhesion and signaling functions may determine outcome impact

This comprehensive approach can reconcile apparently contradictory findings by recognizing EpCAM's context-dependent roles across different cancer types and progression stages.

What emerging technologies will advance our understanding of EpCAM structure-function relationships?

Cutting-edge technologies poised to revolutionize EpCAM research include:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy: Determine complete structure of full-length EpCAM in native membrane environment

    • Integrative structural biology: Combine X-ray crystallography, NMR, and computational modeling

    • Single-molecule FRET: Examine conformational dynamics during binding events

    • Super-resolution techniques: Visualize EpCAM nanoclusters and their relationship to function

  • Protein Engineering and Synthetic Biology:

    • Optogenetic EpCAM variants: Control activation with light to dissect temporal aspects of signaling

    • CRISPR base editing: Introduce precise mutations to test structure-function hypotheses

    • Domain-swapping approaches: Create chimeric proteins to map functional domains

    • Synthetic receptor systems: Develop artificial receptors mimicking EpCAM functions

  • Advanced Cell Biology Tools:

    • Organoid-on-chip systems: Study EpCAM in complex 3D tissues with controlled microenvironments

    • Live-cell proteomics: Track dynamic interaction networks in real-time

    • Single-cell multi-omics: Correlate EpCAM expression with transcriptome, proteome, and metabolome

    • Cellular tension sensors: Measure mechanical forces at EpCAM-mediated junctions

  • Computational Approaches:

    • Molecular dynamics simulations: Model EpCAM conformational changes during binding and signaling

    • Deep learning for structure prediction: Generate models of unknown domains (e.g., EpICD)

    • Network analysis algorithms: Map EpCAM's position in cellular signaling networks

    • Multi-scale modeling: Connect molecular dynamics to tissue-level behaviors

These emerging technologies will help resolve key questions about how EpCAM's structural features enable its diverse cellular functions and how these mechanisms can be therapeutically targeted.

What methodological innovations could improve EpCAM-based liquid biopsy approaches?

Next-generation liquid biopsy approaches for EpCAM-expressing cells will benefit from these methodological innovations:

  • Advanced Capture Technologies:

    • Integrated microfluidic systems: Combine negative depletion with positive selection

    • Aptamer-based capture: Develop DNA/RNA aptamers targeting multiple EpCAM epitopes

    • Nanopatterned substrates: Optimize surface topography for enhanced CTC capture

    • Acoustic/dielectrophoretic methods: Supplement immunocapture with label-free enrichment

  • Multi-marker Detection Strategies:

    • Multiplexed antibody panels: Combine EpCAM with other epithelial, mesenchymal, and stemness markers

    • Single-cell phenotyping platforms: Characterize captured cells across multiple parameters

    • In situ RNA analysis: Perform targeted transcriptomics on captured cells

    • Live-cell functional assays: Test drug responses of captured cells

  • Analytical Sensitivity Enhancements:

    • Signal amplification chemistry: Implement rolling circle amplification or tyramide signal amplification

    • Digital PCR techniques: Detect rare EpCAM-positive events with absolute quantification

    • Nanoparticle-enhanced detection: Apply quantum dots or surface-enhanced Raman spectroscopy

    • Machine learning algorithms: Develop automated classification of rare events

  • Clinical Implementation Strategies:

    • Point-of-care devices: Develop simplified workflows suitable for clinical settings

    • Sample preservation innovations: Improve stability of EpCAM epitopes during transport

    • Standardized analytical pipelines: Create consensus protocols for enumeration and characterization

    • Complementary liquid biopsy integration: Combine with circulating tumor DNA and exosome analysis

These methodological innovations will address current limitations in sensitivity, specificity, and clinical utility of EpCAM-based liquid biopsy approaches while accounting for the heterogeneous expression patterns observed in circulating tumor cells.

How might targeting EpCAM's proteolytic processing offer new therapeutic opportunities?

Exploiting EpCAM's regulated intramembrane proteolysis presents novel therapeutic avenues:

  • Targeting Specific Proteolytic Steps:

    • ADAM inhibitors: Block initial cleavage by ADAM17/TACE that generates EpEX

    • γ-secretase modulators: Modify rather than inhibit presenilin activity to alter EpICD generation

    • Site-specific protease targeting: Develop compounds that bind directly to EpCAM cleavage sites

    • Stabilizers of full-length EpCAM: Prevent proteolysis through allosteric binding

  • Disrupting Downstream Signaling:

    • EpICD nuclear translocation inhibitors: Block interaction with FHL2 or β-catenin

    • Transcriptional complex disruptors: Target EpICD/FHL2/β-catenin/Lef-1 complex formation

    • Target gene modulators: Identify and inhibit critical downstream targets

    • Pathway cross-talk inhibitors: Block interaction with Wnt and Ras/Raf pathways

  • Novel Therapeutic Modalities:

    • Proteolysis-targeting chimeras (PROTACs): Induce degradation of specific EpCAM forms

    • Stabilized peptides: Develop mimetics that compete with EpICD for binding partners

    • RNA therapeutics: Target transcript variants with specific siRNAs or antisense oligonucleotides

    • Combination approaches: Pair with conventional therapies based on proteolytic status

  • Methodological Considerations for Drug Development:

    • Develop high-throughput screening assays that specifically detect proteolytic events

    • Create reporter cell lines that visualize cleavage product generation

    • Implement proteomics approaches to monitor fragment generation

    • Establish in vivo models that faithfully recapitulate human EpCAM processing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.