Recombinant Human Epithelial membrane protein 1 (EMP1)

Shipped with Ice Packs
In Stock

Description

Cancer Biology

  • Prognostic Marker: High EMP1 expression correlates with poor survival in bladder urothelial carcinoma (BLCA) and acute lymphoblastic leukemia (ALL) .

  • Apoptosis Regulation: Overexpression in colorectal cancer cells increases caspase-9 activity by 2-fold, inducing mitochondrial apoptosis pathways .

  • Metastasis Suppression: Reduces migration and invasion in gastric and prostate cancers by inhibiting VEGF-C and Rac1 signaling .

Immune Interactions

  • Immune Infiltration: In BLCA, EMP1 expression correlates with CD8+ T cell infiltration and macrophage polarization markers (e.g., CCL2, IL10) .

  • Tumor Microenvironment: Modulates dendritic cell activity via HLA-DPB1 and ITGAX co-expression, enhancing anti-tumor immune responses .

Mechanistic Studies

  • Pathway Enrichment: EMP1 activates PI3K/AKT and neurotrophin signaling in cancer, identified via gene set enrichment analysis (GSEA) .

  • In Vitro Models: Lentiviral overexpression in SW-480 colorectal cells reduces proliferation by 40% and invasion by 50% within 72 hours .

Therapeutic Targeting

  • Biomarker Potential: Low EMP1 levels in colorectal tumors predict advanced T-stage and lymph node metastasis .

  • Immune Modulation: Co-expression with FOXP3 in Tregs suggests roles in immunosuppression, highlighting its dual pro-/anti-tumor effects .

Key Research Findings

Study FocusOutcomeCitation
BLCA Immune InfiltrationEMP1 correlates with CD8+ T cell density and poor prognosis
Colorectal ApoptosisEMP1 upregulates caspase-9 by 2-fold
Prostate MetastasisEMP1 promotes lymph node/lung metastasis via Rac1

Challenges and Future Directions

While EMP1’s role in apoptosis and immune regulation is established, its context-dependent functions (tumor suppressor vs. promoter) require further validation . Advances in recombinant protein engineering, such as site-specific mutagenesis, could clarify its signaling mechanisms and therapeutic applicability.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You may use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
EMP1; B4B; TMP; Epithelial membrane protein 1; EMP-1; CL-20; Protein B4B; Tumor-associated membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
EMP1
Target Protein Sequence
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Uniprot No.

Target Background

Gene References Into Functions
  1. The abnormal expression of EMP-1 may be associated with the progression of laryngeal carcinoma (LC), and the gene may act as a prognostic marker for LC. PMID: 28779068
  2. Studies have highlighted the involvement of the GAS3 protein family (EMP1, EMP2, EMP3, and PMP22) in cancer pathogenesis, as well as the structural similarities between the family members. PMID: 27279240
  3. Therefore, EMP1 functions as a tumor suppressor in laryngeal carcinoma. Enhancing EMP1 expression in laryngeal carcinoma initiates multiple anticancer phenotypes, suggesting a promising therapeutic approach for laryngeal cancer. PMID: 27909719
  4. SOS1 and Ras regulate epithelial tight junction formation in the human airway through EMP1. EMP1 localizes to tight junctions and is crucial for their formation and function. PMID: 25394671
  5. Low EMP1 expression in colorectal cancer is associated with increased disease severity, suggesting that EMP1 may act as a negative regulator of colorectal cancer. PMID: 24744589
  6. Research has shown that EMP1 protein levels are significantly reduced in gastric carcinoma and correlate with tumor invasion, lymph node metastasis, clinical stage, and cell differentiation. PMID: 24920167
  7. EMP1 is an independent predictor for poor outcome in precursor-B ALL (BCP-ALL) (P=0.004, hazard ratio: 2.36 (1.31-4.25). PMID: 24625531
  8. EMP-1 was significantly up-regulated in NSCLC patients. PMID: 23271282
  9. EMP1 expression decreased in prostate cancer and correlated significantly with T stages, lymph node metastasis, clinic stage, and Gleason score. PMID: 24338711
  10. EMP1 could serve as a biomarker for aberrant epithelial remodeling and metaplasia in chronic inflammatory upper airway mucosa. PMID: 24033346
  11. EMP1 may play significant roles as a negative regulator of nasopharyngeal cancer cell growth. PMID: 24292952
  12. EMP1 may play crucial roles as a negative regulator of breast cancer MCF-7 cell by modulating the expression of caspase 9 and VEGFC protein. PMID: 24402572
  13. Overexpression of EMP1 in spinal chondrocytes promotes cell proliferation and survival, alters cell morphology and cell cycle, reduces cell condensation, and inhibits cell hypertrophy. PMID: 21538935
  14. The EMP1 gene may be implicated in the pathophysiology of MDD in the Japanese population. PMID: 21146590
  15. Decreased expression of EMP1 was significantly correlated with clinical stage (p=0.002) and lymph node metastasis (p=0.044) of patients with oral squamous cell carcinoma and may act as a tumor suppressor. PMID: 20980531
  16. The EMP-1 gene exhibits a relationship with esophageal carcinogenesis. PMID: 12451984
  17. Overexpression of the human EMP-1 gene can inhibit the proliferation of EC9706 cells with S phase arrested and G1 phase prolonged. EMP-1 may be a regulator involved in cell signaling, communication, and adhesion. PMID: 12632483
  18. The adhesion molecule, EMP-1, has been identified as a biomarker of gefitinib clinical resistance, suggesting a potential interaction between this molecule and the epidermal growth factor receptor signaling pathway. PMID: 16087880
  19. Gene scanning revealed higher expression of EMP-1 mRNA in intractable epilepsy patients. EMP-1 immunoreactivity was observed in neurons of IE patients but not in the control group, and the expression of EMP-1 and EGFR co-occurred in the same neuron. PMID: 19288191

Show More

Hide All

Database Links

HGNC: 3333

OMIM: 602333

KEGG: hsa:2012

STRING: 9606.ENSP00000256951

UniGene: Hs.719042

Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of EMP1?

EMP1 belongs to the epithelial membrane protein family and possesses four putative transmembrane domain structures. It consists of approximately 160 amino acid residues and is encoded by the growth arrest-specific 3 (GAS3)/peripheral myelin protein 22 kDa (PMP22) gene family. The protein has a topology similar to members of the tetraspanin superfamily, also known as the transmembrane 4 superfamily (TM4SF) .

Structurally, EMP1 shares characteristics with other membrane proteins that facilitate cellular interactions and signaling across membrane boundaries. This structural configuration is critical for its roles in cellular communication and signal transduction processes.

What are the primary physiological functions of EMP1?

EMP1 plays crucial roles in multiple cellular processes including:

  • Cell migration and motility

  • Cellular growth regulation

  • Cell differentiation

  • Intercellular communication

  • Tumor microenvironment (TME) remodeling

How does EMP1 expression vary across normal versus cancerous tissues?

EMP1 expression exhibits tissue-specific patterns that are often altered during malignant transformation. The expression pattern varies significantly depending on cancer type:

Upregulated in:

  • Glioblastoma multiforme (GBM) compared to normal brain tissue

  • Prostate cancer, particularly at the invasive front

  • Triple-negative breast cancer (TNBC) and basal-like breast cancer subtypes

  • Acute lymphoblastic leukemia (ALL), particularly in prednisolone-resistant cases

Downregulated in:

  • Nasopharyngeal cancer compared to normal nasopharyngeal tissues

  • Esophageal cancer compared to adjacent normal tissues

  • Gastric cancer compared to normal gastric tissues

  • Colorectal cancer (39.7% tissues positive) compared to normal colorectal tissues (90.3% positive)

  • High-grade serous ovarian cancer compared to benign ovarian tumors

This differential expression pattern underscores the context-dependent role of EMP1 in cancer progression.

What are the key considerations when designing experiments with recombinant EMP1?

When designing experiments with recombinant EMP1, researchers should consider:

  • Expression System Selection: Choose an appropriate expression system that maintains proper post-translational modifications essential for EMP1 function. Mammalian expression systems are often preferred for maintaining physiological relevance.

  • Protein Tagging Strategy: Consider whether N-terminal or C-terminal tags might interfere with protein folding or function. Given EMP1's transmembrane nature, tag placement can significantly impact its localization and activity.

  • Validation Methods: Include multiple validation techniques to confirm proper expression and localization, such as:

    • Western blotting for expression level confirmation

    • Immunofluorescence for subcellular localization

    • Functional assays specific to EMP1 activity

  • Controls: Implement appropriate controls including:

    • Empty vector controls

    • Inactive mutant versions of EMP1

    • Wild-type EMP1 for comparison with mutant variants

  • Experimental Design Principles: Follow standard experimental design principles including minimizing bias through techniques like blind analysis and ensuring adequate statistical power through appropriate sample sizing3.

What are effective methods to measure EMP1 activity in experimental settings?

Effective methods for measuring EMP1 activity include:

Cell Migration and Invasion Assays:

  • Transwell migration assays to quantify the impact of EMP1 on cellular motility

  • Wound healing assays to assess collective cell migration

  • 3D matrix invasion assays to evaluate invasive capacity

Signaling Pathway Analysis:

  • Western blotting to detect activation of downstream effectors like Rac1

  • Immunoprecipitation to identify protein-protein interactions

  • Phospho-specific antibody analysis to detect activation of signaling molecules in the PI3K/AKT/mTOR pathway

Transcriptomic and Proteomic Analysis:

  • RNA sequencing to identify gene expression changes influenced by EMP1

  • Proteomics to detect alterations in the cellular proteome

  • ChIP-seq to identify transcription factors affected by EMP1 signaling

Cell-Cell Communication Assays:

  • Co-culture systems of cancer cells with stromal cells to assess EMP1's role in cell-cell communication

  • Cytokine profiling to measure changes in secreted factors like IL6

  • Conditioned media experiments to evaluate paracrine signaling effects

How can researchers effectively model EMP1's role in cancer progression?

Researchers can utilize various models to study EMP1's role in cancer:

In Vitro Models:

  • Cell Line Selection: Choose cancer cell lines with varying endogenous EMP1 expression levels. For studying TNBC, cell lines like MDA-MB-231, BT-549, or HCC1937 are recommended based on their well-characterized EMP1 expression patterns.

  • Genetic Manipulation Approaches:

    • CRISPR/Cas9 for gene knockout

    • shRNA for stable knockdown

    • Overexpression vectors for ectopic expression

    • Inducible expression systems for temporal control

  • Co-Culture Systems:

    • Cancer cells with cancer-associated fibroblasts (CAFs) to mimic tumor microenvironment

    • Cancer cells with immune cells to study immunomodulatory effects

    • 3D organoid cultures to better recapitulate tumor architecture

In Vivo Models:

  • Xenograft Models: Implantation of EMP1-modified cancer cells into immunocompromised mice to assess:

    • Primary tumor growth

    • Metastatic potential to lymph nodes and lungs

    • Tumor microenvironment remodeling

  • Patient-Derived Xenografts (PDXs): Implantation of patient tumor fragments to maintain tumor heterogeneity and better recapitulate human disease.

  • Genetically Engineered Mouse Models (GEMMs): Development of transgenic mice with tissue-specific alterations in EMP1 expression to study cancer initiation and progression in an immunocompetent setting.

What techniques are most effective for studying EMP1's role in tumor microenvironment remodeling?

To study EMP1's role in tumor microenvironment remodeling, researchers can employ:

Cellular Deconvolution Analysis:

  • Utilize algorithms like xCell to analyze bulk RNA-seq data and evaluate infiltration levels of various cell types in the tumor microenvironment

  • Correlate EMP1 expression with tumor microenvironment scores, stromal scores, and specific cell type infiltration patterns

Advanced Imaging Techniques:

  • Multiplex immunohistochemistry to simultaneously visualize multiple cell types

  • Spatial transcriptomics to map gene expression within the tumor and surrounding stroma

  • Intravital imaging to observe cell-cell interactions in real-time in vivo

Functional Assessment:

  • Cell co-culture assays with cancer cells and CAFs to evaluate the impact of EMP1 on CAF recruitment and activation

  • Conditioned media experiments to identify secreted factors regulated by EMP1

  • Extracellular matrix (ECM) remodeling assays to assess how EMP1 affects matrix composition and stiffness

Molecular Profiling:

  • Cytokine arrays to identify soluble factors mediating EMP1-dependent communication between cancer cells and stromal cells

  • Single-cell RNA sequencing to characterize heterogeneous cell populations within the tumor microenvironment

  • ChIP-seq to identify transcriptional networks regulated by EMP1 that influence stromal cell recruitment

How does EMP1 regulate bidirectional signaling between cancer cells and the tumor microenvironment?

EMP1 appears to play a critical role in mediating communication between cancer cells and surrounding stromal cells, particularly cancer-associated fibroblasts (CAFs). Recent research has revealed several key mechanisms:

  • Cytokine Signaling Regulation:

    • EMP1 expression in cancer cells regulates IL6 secretion through the NF-κB signaling pathway

    • This IL6 secretion directly influences CAF proliferation and activation

    • EMP1 knockdown results in decreased IL6 production, hindering CAF infiltration and activity

  • CAF Recruitment and Activation:

    • High EMP1 expression positively correlates with increased CAF infiltration, as evidenced by elevated αSMA expression in tumor samples

    • This correlation is particularly strong in triple-negative breast cancer (TNBC) patients

    • Cell co-culture experiments confirm that EMP1-expressing cancer cells enhance CAF proliferation and activation

  • Feedback Loop Mechanisms:

    • Activated CAFs further promote cancer cell invasion and migration

    • This creates a positive feedback loop where EMP1-expressing cancer cells recruit CAFs, which in turn enhance cancer aggressiveness

    • Targeting EMP1 disrupts this feedback loop, potentially inhibiting tumor progression

The bidirectional nature of this signaling highlights EMP1's role as a central mediator in tumor-stroma interactions, making it a promising therapeutic target for disrupting the tumor microenvironment.

What are the molecular mechanisms underlying EMP1's dual role as both tumor promoter and suppressor?

EMP1 exhibits context-dependent functions across different cancer types, acting as either a tumor promoter or suppressor. The molecular mechanisms underlying this dual functionality include:

Tumor-Promoting Mechanisms:

  • Rac1 Activation Pathway:

    • In prostate cancer, EMP1 activates the small GTPase Rac1

    • This activation enhances cancer cell migration and invasion

    • Leads to increased metastasis to lymph nodes and lungs in animal models

  • CD44/MMP2 Regulation:

    • In glioblastoma, EMP1 upregulates CD44 and matrix metalloprotease-2 (MMP-2)

    • CD44 isoforms stimulate uncontrolled growth of glioma stem cells

    • MMP-2 facilitates extracellular matrix degradation and invasion

  • PI3K/AKT/mTOR Pathway Activation:

    • EMP1 enhances signaling through the PI3K/AKT/mTOR pathway

    • This activates downstream transcription factors including OCT4, SOX2, and Nanog

    • Promotes stem cell-like properties and treatment resistance

Tumor-Suppressing Mechanisms:

This functional duality appears to be regulated by tissue-specific contexts, genetic background, and the tumor microenvironment, suggesting complex regulatory mechanisms that control EMP1's ultimate effect on cancer progression.

What are the critical considerations when interpreting contradictory results in EMP1 research?

When encountering contradictory results in EMP1 research, consider these critical factors:

Tissue Context and Cancer Subtype:

  • EMP1's function varies significantly across different tissues and cancer subtypes

  • For example, EMP1 promotes cancer progression in prostate cancer and GBM but suppresses it in nasopharyngeal and gastrointestinal cancers

  • Even within breast cancer, EMP1's role differs between lobular and ductal subtypes

Methodological Variations:

  • Expression analysis methods (mRNA vs. protein levels) may yield different results

  • In situ analysis of patient samples versus in vitro cell line models may produce seemingly contradictory findings

  • Different knockdown or overexpression techniques may have varying efficiencies and off-target effects

Tumor Microenvironment Influences:

  • Studies in isolated cancer cells versus co-culture systems or in vivo models with intact tumor microenvironments may produce different results

  • EMP1's effect may depend on the presence of specific stromal components like CAFs

  • The immunological status of the model (immunocompetent vs. immunodeficient) could significantly impact outcomes

Experimental Design Considerations:

To address these contradictions, researchers should:

  • Clearly define the specific context of their studies

  • Use multiple complementary approaches to validate findings

  • Consider the tumor microenvironment in experimental design

  • Implement robust statistical analysis to control for confounding variables

  • Transparently report limitations and potential alternative interpretations

How can EMP1 expression patterns be effectively used as prognostic biomarkers?

EMP1 expression patterns offer significant potential as prognostic biomarkers across various cancer types, with important methodological considerations:

Cancer-Specific Prognostic Value:

Cancer TypeEMP1 ExpressionPrognostic ImplicationEvidence Quality
Triple-negative breast cancerHighPoor prognosisStrong, multiple cohorts
Nasopharyngeal cancerLowPoor prognosisModerate, single cohort
Colorectal cancerLowPoor prognosisStrong, large cohort analysis
GlioblastomaHighPoor prognosisModerate, mechanistic evidence
Prostate cancerHigh at invasive frontIncreased malignancyModerate, validated in animal models

Methodological Approaches for Biomarker Development:

  • Sample Collection and Processing:

    • Use standardized protocols for tissue collection and preservation

    • Consider tumor heterogeneity by sampling multiple regions

    • Establish clear cutoff values for "high" versus "low" expression based on calibrated controls

  • Detection Methods:

    • Immunohistochemistry (IHC) for protein-level detection in tissue sections

    • RT-qPCR for mRNA quantification in fresh or preserved samples

    • RNA sequencing for comprehensive expression profiling

  • Analytical Considerations:

    • Incorporate multivariate analysis to control for confounding clinical factors

    • Consider EMP1 expression in conjunction with established prognostic markers

    • Validate findings across independent patient cohorts

  • Integration with Other Biomarkers:

    • Combine EMP1 with stromal markers like αSMA for improved prognostic value

    • Correlate with immune infiltration markers for comprehensive TME assessment

    • Consider molecular subtyping information for context-specific interpretation

What are the most promising approaches for targeting EMP1 in cancer therapeutics?

Based on current research, several approaches show promise for targeting EMP1 in cancer therapeutics:

Direct EMP1 Targeting Strategies:

  • RNA Interference Technology:

    • siRNA or shRNA approaches to knockdown EMP1 expression

    • Demonstrated efficacy in reducing cancer cell proliferation, migration, and invasion in multiple cancer models

    • Delivery challenges remain a significant hurdle for clinical translation

  • CRISPR/Cas9 Gene Editing:

    • Potential for permanent EMP1 knockout in cancer cells

    • May be applicable in ex vivo therapeutic approaches

    • Still faces delivery challenges for in vivo applications

  • Small Molecule Inhibitors:

    • Design of compounds targeting EMP1 protein-protein interactions

    • Structure-based drug design approaches targeting EMP1's transmembrane domains

    • High-throughput screening of compound libraries for EMP1 functional inhibition

Indirect Targeting Approaches:

  • NF-κB Pathway Inhibition:

    • Targeting the NF-κB signaling pathway to disrupt EMP1-mediated IL6 secretion

    • Several NF-κB inhibitors are already in clinical development

    • May block the communication between cancer cells and CAFs

  • Disrupting CAF Recruitment:

    • Targeting the EMP1-dependent tumor-stroma communication

    • Blocking IL6 or other cytokines involved in CAF recruitment and activation

    • Combined approaches targeting both cancer cells and CAFs

  • Combination Therapies:

    • Sensitizing resistant cancer cells by targeting EMP1-mediated resistance mechanisms

    • Particularly promising in acute lymphoblastic leukemia where EMP1 contributes to prednisolone resistance

    • May enhance efficacy of existing therapies when combined with EMP1 inhibition

The most promising approaches will likely involve precision medicine strategies that consider the context-dependent role of EMP1 across different cancer types and subtypes.

What expression systems yield optimal functional recombinant EMP1 for research applications?

Producing functional recombinant EMP1 presents unique challenges due to its membrane-associated nature. The optimal expression systems include:

Mammalian Expression Systems:

Insect Cell Systems:

  • Sf9/Sf21 Cells: Suitable for high-level expression of membrane proteins

  • Advantages: Higher yields than mammalian systems with reasonable post-translational modifications

  • Disadvantages: Glycosylation patterns differ from mammalian cells

Cell-Free Expression Systems:

  • Advantages: Allows for direct incorporation into liposomes or nanodiscs

  • Suitable for: Structural studies and protein-protein interaction assays

  • Disadvantages: May not replicate all functional aspects of native EMP1

Wheat Germ Systems:

  • Similar to what has been used for other membrane proteins like Aquaporin 1

  • Provides good yields for initial characterization studies

  • May lack some mammalian-specific modifications

Optimization Parameters for Functional EMP1:

  • Temperature control during expression (typically lower temperatures improve folding)

  • Addition of specific lipids to support proper membrane insertion

  • Use of fusion tags that enhance solubility while maintaining function

  • Gentle detergent selection for extraction that preserves protein structure

What are the most effective purification strategies for maintaining EMP1 structure and function?

Purifying membrane proteins like EMP1 while preserving structure and function requires specialized approaches:

Membrane Extraction Strategies:

  • Detergent Selection:

    • Mild non-ionic detergents (DDM, LMNG) are preferred for initial extraction

    • Detergent concentration should be optimized to minimize protein denaturation

    • Detergent exchange during purification may improve protein stability

  • Solubilization Conditions:

    • Buffer optimization including pH, ionic strength, and stabilizing additives

    • Addition of cholesterol or specific lipids to maintain native-like environment

    • Temperature control during extraction process (typically 4°C)

Purification Methods:

  • Affinity Chromatography:

    • His-tag or FLAG-tag affinity purification as initial capture step

    • Tandem affinity purification (e.g., His-tag plus additional tag) for higher purity

    • On-column detergent exchange to more stabilizing conditions

  • Size Exclusion Chromatography:

    • Critical for removing protein aggregates and ensuring homogeneity

    • Allows buffer exchange to optimal stabilization conditions

    • Analytical tool to assess protein oligomeric state

  • Reconstitution Approaches:

    • Incorporation into nanodiscs for a more native-like lipid environment

    • Proteoliposome formation for functional studies

    • Amphipol exchange for improved stability in detergent-free conditions

Quality Control Assessments:

  • Functional Validation:

    • Cell-based assays to confirm activity of purified protein

    • Interaction studies with known binding partners

    • Assessment of downstream signaling activation

  • Structural Integrity:

    • Circular dichroism to assess secondary structure

    • Thermal stability assays to determine protein stability

    • Limited proteolysis to evaluate proper folding

These strategies must be optimized specifically for EMP1, as each membrane protein has unique requirements for maintaining structural and functional integrity.

What are the emerging technologies that could advance EMP1 research?

Several cutting-edge technologies show promise for advancing EMP1 research:

  • Single-Cell Multi-Omics Approaches:

    • Integration of single-cell transcriptomics, proteomics, and epigenomics

    • Enables detailed characterization of EMP1's role in heterogeneous tumor populations

    • Provides insights into cell-specific responses to EMP1 modulation

  • Advanced Imaging Technologies:

    • Super-resolution microscopy for detailed protein localization studies

    • Live-cell imaging with fluorescently tagged EMP1 to track dynamic cellular responses

    • Correlative light and electron microscopy to link function with ultrastructural features

  • Organoid and Microfluidic Systems:

    • Patient-derived organoids to study EMP1 in personalized tumor models

    • Organ-on-chip technologies to recapitulate complex tissue microenvironments

    • Tumor-stroma co-culture systems with controlled spatial organization

  • Artificial Intelligence and Machine Learning:

    • Network analysis to identify novel interaction partners of EMP1

    • Prediction of patient responses to EMP1-targeted therapies

    • Automated image analysis for high-throughput phenotypic screening

  • CRISPR Screening Technologies:

    • CRISPR activation/interference screens to identify synthetic lethal interactions

    • Base editing approaches for introducing specific EMP1 mutations

    • In vivo CRISPR screens to identify context-dependent modulators of EMP1 function

What are the most critical unanswered questions regarding EMP1 biology?

Despite significant advances, several critical questions about EMP1 biology remain unanswered:

  • Structural Determinants of Function:

    • What are the specific protein domains responsible for EMP1's diverse functions?

    • How does the three-dimensional structure of EMP1 contribute to its signaling capabilities?

    • What post-translational modifications regulate EMP1 activity?

  • Context-Dependent Activity:

    • What molecular mechanisms explain EMP1's opposing roles across different cancer types?

    • How do tissue-specific factors determine whether EMP1 functions as a tumor promoter or suppressor?

    • What genetic or epigenetic factors regulate EMP1 expression in different cellular contexts?

  • Signaling Network Integration:

    • How does EMP1 integrate into broader signaling networks within cancer cells?

    • What are the direct binding partners of EMP1 that mediate its effects?

    • How does EMP1 coordinate communication between multiple cell types in the tumor microenvironment?

  • Therapeutic Targeting:

    • Can EMP1 be directly targeted with small molecules or biologics?

    • What combination therapeutic strategies might overcome resistance mechanisms?

    • How can EMP1-based biomarkers be integrated into precision medicine approaches?

  • Evolutionary Conservation:

    • What are the evolutionarily conserved functions of EMP1 across species?

    • How has EMP1's role evolved in relation to tissue complexity?

    • What can comparative biology teach us about EMP1's fundamental biological roles?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.