Recombinant Human Epithelial membrane protein 2 (EMP2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics of Recombinant Human EMP2

Recombinant Human Epithelial Membrane Protein 2 (EMP2) is a full-length protein spanning amino acids 1–167, expressed via wheat germ-based systems for research applications . This tetraspan protein belongs to the growth arrest-specific gene 3/peripheral myelin protein-22 (GAS3/PMP22) family and contains four transmembrane domains . Its structure facilitates interactions with integrins (e.g., αvβ3) and signaling molecules like focal adhesion kinase (FAK) and Src .

Key Features of Recombinant EMP2:

PropertyDescriptionSource
Amino Acid Range1–167 (full-length)
Expression SystemWheat germ
ApplicationsSDS-PAGE, ELISA, Western blotting
Interacting Partnersαvβ3 integrin, FAK, Src kinase

Expression and Clinical Relevance in Cancer

EMP2 Expression in Cancers:

Cancer TypeExpression FrequencyPrognostic CorrelationSource
Glioblastoma (GBM)95% of patientsHigh levels → Poor survival
Ovarian Cancer>70% of tumorsHigh levels → Tumor growth
Breast CancerElevated in malignant tissuesAssociated with molecular subtypes
Endometrial CancerHigh expressionPoor survival

Functional Roles in Cellular Processes

EMP2 modulates critical signaling pathways and cellular behaviors:

3.1. Integrin-Mediated Signaling

  • αvβ3 Integrin Regulation: EMP2 enhances αvβ3 surface expression, promoting FAK/Src activation and cell migration .

  • Collagen Gel Contraction: Overexpression in ARPE-19 cells increases FAK activation by 70%, enhancing extracellular matrix remodeling .

3.2. Tumor Progression

  • Invasiveness: In GBM models, EMP2 increases tumor cell invasion via FAK/Src activation .

  • Growth Promotion: Overexpression accelerates subcutaneous xenograft growth in GBM and ovarian cancer models .

Therapeutic Targeting of EMP2

Antibody-based therapies targeting EMP2 show promise in preclinical models:

Therapeutic Approaches:

Disease ModelMethodOutcomeSource
GlioblastomaAnti-EMP2 antibodiesReduced tumor load in subcutaneous models
Ovarian CancerEMP2 diabodiesInhibited growth, induced apoptosis
Lung DisordersEMP2-targeting agentsReduced neutrophil infiltration

Research Methodologies and Challenges

Studies employ diverse techniques to study EMP2:

MethodApplicationFindingsSource
ShRNA KnockdownGBM cell linesReduced tumor growth and invasion
Anti-EMP2 DiabodiesOvarian cancer xenograftsSuppressed tumor growth
EMP2-/- MiceLung inflammation modelsReduced PMN transmigration

Mechanistic Insights and Pathway Interactions

EMP2’s role in lipid raft organization and signaling is critical:

  • Lipid Raft Scaffolding: EMP2 regulates membrane organization in alveolar epithelial cells, influencing neutrophil migration .

  • CRAC/CARC Domains: Mutagenesis of cholesterol-binding motifs disrupts raft formation, impairing EMP2’s functional role .

Future Directions and Challenges

While EMP2 shows therapeutic potential, challenges remain:

  1. Tissue-Specific Expression: High specificity in lung epithelium allows localized targeting but limits systemic applications .

  2. Mechanistic Complexity: EMP2’s dual roles in promoting and inhibiting cell behaviors (e.g., migration vs. proliferation) require context-specific modulation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
EMP2; XMP; Epithelial membrane protein 2; EMP-2; Protein XMP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
EMP2
Target Protein Sequence
MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST LQAVQATMILSTILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRR EDIHDKNAKFYPVTREGSYGYSYILAWVAFACTFISGMMYLILRKRK
Uniprot No.

Target Background

Function
Epithelial membrane protein 2 (EMP2) acts as a crucial regulator of cell membrane composition by controlling protein surface expression. It plays a significant role in regulating various cellular processes including cell migration, proliferation, contraction, and adhesion. EMP2 negatively regulates caveolae formation by reducing CAV1 expression and CAV1 levels through increased lysosomal degradation. It facilitates surface trafficking and the formation of lipid rafts containing GPI-anchor proteins. EMP2 regulates the surface expression of MHC1 and ICAM1 proteins, increasing susceptibility to T-cell mediated cytotoxicity. It modulates cell-matrix adhesion by controlling the plasma membrane expression of integrin heterodimers ITGA6-ITGB1, ITGA5-ITGB3, and ITGA5-ITGB1. EMP2 also regulates many processes through PTK2. It regulates blood vessel endothelial cell migration and angiogenesis by modulating VEGF protein expression via PTK2 activation. It regulates cell migration and contraction through PTK2 and SRC activation. EMP2 regulates focal adhesion density, F-actin conformation, and cell adhesion capacity by interacting with PTK2. It positively regulates cell proliferation. EMP2 plays a role in cell death and blebbing. It promotes angiogenesis and vasculogenesis by inducing VEGFA via a HIF1A-dependent pathway. EMP2 also plays a role in embryo implantation by regulating surface trafficking of integrin heterodimer ITGA5-ITGB3. It may be involved in glomerular filtration.
Gene References Into Functions
  1. EMP2 is a biomarker in gliomas and has potential as a molecular target for the diagnosis and treatment of gliomas. PMID: 28887715
  2. Elevated EMP2 expression is associated with endometrial cancer. PMID: 28604744
  3. In vitro experiments using human trophoblast cell lines indicate that EMP2 modulates angiogenesis by altering HIF-1alpha expression. These findings reveal a novel role for EMP2 in regulating trophoblast function and vascular development in mice and humans, suggesting that it may be a new biomarker for placental insufficiency. PMID: 28295343
  4. All studied ERMs and PVR membranes express EMP2. EMP2 levels tend to be higher in all PVR subgroups compared to ERMs, particularly in inflammatory and traumatic PVR. PMID: 27294805
  5. A novel SNP x SNP interaction between rs2267668 in PPARdelta and rs7191411 in EMP2 significantly impacts circulating HDL-C levels in the Singaporean Chinese population. PMID: 27530449
  6. Data suggest that EMP2 loss is common, and its re-expression may serve as an approach to enhance radiation sensitivity in nasopharyngeal carcinoma. PMID: 28347228
  7. Research shows that EMP2 loss is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1). PMID: 26876307
  8. EMP2 plays a tumor suppressor role by inducing G2/M cell cycle arrest, suppressing cell viability, proliferation, and colony formation/anchorage-independent cell growth through the regulation of G2/M checkpoints in distinct-derived cell lines. PMID: 25940704
  9. Loss of EMP2 is associated with nasopharyngeal carcinoma. PMID: 25684502
  10. EMP2's role in the pathogenesis of GBM is being investigated. PMID: 24644285
  11. Knockdown of EMP2 in podocytes and endothelial cells resulted in increased CAVEOLIN-1 levels and decreased cell proliferation. EMP2 mutations are associated with a recessive Mendelian form of steroid-sensitive nephrotic syndrome. PMID: 24814193
  12. EMP2 was identified as a tumor-suppressor gene in urinary tract urothelial carcinoma. PMID: 23838430
  13. Findings support the role of EMP2 in controlling the tumor microenvironment and confirm the cytotoxic effects observed with EMP2 treatment in vivo. PMID: 23334331
  14. Manipulating EMP2 levels in endometrial cancer cells regulates the phosphorylation of FAK and Src, promoting their distribution into lipid raft domains. PMID: 21637765
  15. EMP2 is expressed in the majority of ovarian tumors and may be a viable therapeutic target in vivo. PMID: 20670949
  16. EMP2 is a candidate gene for Charcot-Marie-Tooth disease type 1C on chromosome 16p. PMID: 11713717
  17. This protein is expressed in specific anatomical regions of the eye. PMID: 12710941
  18. EMP2 induces alphavbeta3 surface expression. PMID: 16216233
  19. These findings identify EMP2 as a candidate host protein involved in infection of Chlamydia muridarum. [EMP-2] PMID: 17544801
  20. EMP2 regulates caveolin-1 transcription and more substantially its protein levels. PMID: 17609206
  21. Targeting EMP2 to specific locations under the influence of steroid hormones may be essential for integrating the molecular responses required for implantation competence. PMID: 18400107
  22. EMP2 is a potential pharmacologic target for human endometrial cancer. PMID: 19010852

Show More

Hide All

Database Links

HGNC: 3334

OMIM: 602334

KEGG: hsa:2013

STRING: 9606.ENSP00000352540

UniGene: Hs.531561

Involvement In Disease
Nephrotic syndrome 10 (NPHS10)
Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane. Apical cell membrane. Membrane raft. Cytoplasm. Nucleus.
Tissue Specificity
Expressed in ciliary body epithelia, sclera, cornea, and retinal pigment epithelium (at protein level).

Q&A

What is the molecular structure and cellular localization of Epithelial Membrane Protein 2?

Epithelial Membrane Protein 2 (EMP2) is a tetraspan protein from the Growth Arrest Specific-3/Peripheral Myelin Protein-22 (GAS3/PMP22) family of tetraspan proteins. It contains four transmembrane domains with both N-terminal and C-terminal domains positioned intracellularly. EMP2 is primarily localized in the plasma membrane, where it participates in the organization of membrane microdomains. It plays a crucial role in regulating the surface display and signaling from select integrin pairs through its ability to organize lipid raft domains. The protein has been shown to directly associate with integrin αvβ3 and focal adhesion kinase (FAK), promoting integrin-mediated FAK-Src activation, which is essential for its cellular functions .

How does EMP2 differ from other tetraspan proteins in terms of function and tissue expression?

While many tetraspan proteins are widely expressed across multiple tissues, EMP2 shows a more restricted expression pattern, with notable expression in epithelial cells of various organs. Unlike classical tetraspanins (CD9, CD63, CD81, etc.), which typically associate with multiple partner proteins, EMP2 appears to have more selective protein interactions, particularly with specific integrin pairs.

The functional distinction lies in EMP2's specific roles in:

  • Regulating integrin trafficking and signaling through direct association with integrin αvβ3

  • Promoting FAK-Src signaling activation

  • Contributing to cell adhesion, migration, and invasion processes

  • Potentially influencing cellular differentiation in epithelial tissues

These specialized functions distinguish EMP2 from broader-acting tetraspan proteins that may have more generalized membrane organizing functions .

What are the standardized methods for producing recombinant human EMP2 for research purposes?

The production of recombinant human EMP2 typically involves:

  • Expression System Selection: Mammalian expression systems (HEK293 or CHO cells) are preferred over bacterial systems due to the need for proper protein folding and post-translational modifications.

  • Vector Construction:

    • Cloning the full-length human EMP2 cDNA into an appropriate expression vector

    • Adding a purification tag (His-tag, FLAG-tag, or GST-tag) to facilitate purification

    • Incorporating a signal peptide for proper membrane targeting

  • Transfection and Selection:

    • Stable transfection of host cells

    • Selection of high-expressing clones using antibiotic resistance

  • Protein Extraction:

    • Membrane fraction isolation using differential centrifugation

    • Solubilization with mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS)

  • Purification:

    • Affinity chromatography based on the incorporated tag

    • Size exclusion chromatography for final purification

  • Verification:

    • Western blot analysis with anti-EMP2 antibodies

    • Mass spectrometry confirmation

    • Functional verification through integrin binding assays

What is the significance of EMP2 expression in various cancer types, particularly in ovarian and endometrial cancers?

EMP2 has emerged as a significant biomarker with potential therapeutic implications in multiple cancer types. Research data demonstrates particularly important roles in ovarian and endometrial cancers:

Ovarian Cancer:

  • High expression in over 70% of serous and endometrioid ovarian tumors compared to non-malignant ovarian epithelium

  • Expression across multiple ovarian cancer cell lines, suggesting a common role in ovarian carcinogenesis

  • Potential involvement in tumor growth and progression through integrin signaling pathways

Endometrial Cancer:

  • Identified as an independent prognostic biomarker

  • Associated with more aggressive disease phenotypes

  • Linked to increased integrin signaling and FAK activation

This expression profile suggests EMP2 may serve as both a diagnostic biomarker and therapeutic target in gynecologic malignancies, with particular relevance in the most common ovarian cancer subtypes (serous and endometrioid) that represent 90-95% of ovarian cancers diagnosed in North America .

How does EMP2 contribute to cancer cell biology through its interaction with integrins and FAK?

EMP2 plays a crucial role in cancer cell biology through a complex network of molecular interactions:

  • Integrin Trafficking and Organization:

    • EMP2 regulates the surface display of select integrin pairs

    • Facilitates the formation of integrin-rich membrane domains

    • Enhances integrin clustering and activation

  • FAK-Src Signaling Axis:

    • Direct biochemical association with integrin αvβ3 and FAK

    • Promotes integrin-mediated FAK phosphorylation and activation

    • Facilitates the recruitment and activation of Src kinase

    • Triggers downstream signaling cascades including MAPK/ERK and PI3K/AKT pathways

  • Cellular Consequences:

    • Enhanced cell adhesion to extracellular matrix components

    • Increased cell migration and invasion potential

    • Promotion of cell survival and resistance to apoptosis

    • Facilitation of angiogenesis through integrin-dependent mechanisms

The EMP2-integrin-FAK signaling axis appears to create a pro-oncogenic signaling hub that supports multiple cancer hallmarks, including sustained proliferation, invasion, metastasis, and angiogenesis .

What experimental models are most effective for studying EMP2 function in cancer progression?

Several experimental models have proven effective for investigating EMP2's role in cancer progression:

In Vitro Models:

  • Cell Line Panels: Using multiple cancer cell lines with varying EMP2 expression levels allows correlation of expression with phenotypic characteristics.

  • Genetic Manipulation Systems:

    • Stable transfection with EMP2 overexpression constructs

    • EMP2 knockdown using shRNA, siRNA, or CRISPR-Cas9

    • Inducible expression systems for temporal control

  • Functional Assays:

    • Proliferation assays (MTT, BrdU incorporation)

    • Migration/invasion assays (Transwell, wound healing)

    • 3D culture systems (spheroids, organoids)

    • Adhesion assays to various ECM components

In Vivo Models:

  • Xenograft Models: Cell line-derived xenografts using EMP2-manipulated cell lines have demonstrated EMP2's impact on tumor growth and response to therapy.

  • Patient-Derived Xenografts (PDX): Preserving tumor heterogeneity and microenvironment interactions.

  • Genetic Mouse Models: Though less common for EMP2 specifically, conditional knockout or transgenic overexpression models can provide insights into tissue-specific effects.

Research indicates that combined approaches using both in vitro and in vivo models provide the most comprehensive assessment of EMP2's functions in cancer progression .

How effective are anti-EMP2 recombinant antibody fragments in preclinical models of cancer?

Anti-EMP2 recombinant antibody fragments, particularly diabodies (bivalent antibody fragments), have shown promising efficacy in preclinical cancer models:

In Vitro Findings:

  • Treatment with anti-EMP2 diabodies induced significant cell death and retarded cell growth in multiple ovarian cancer cell lines

  • Efficacy correlated with cellular EMP2 expression levels, suggesting target specificity

  • Mechanism appears to involve dysregulation of the integrin-FAK signaling nexus, leading to apoptosis

In Vivo Results:

  • Anti-EMP2 diabodies significantly suppressed tumor growth in ovarian endometrioid carcinoma (OVCAR5) xenograft models

  • Induced cell death was observed in the treated xenografts

  • Treatment was well-tolerated without obvious toxicity

  • The degree of response appeared to correlate with EMP2 expression levels

These preclinical findings suggest that targeting EMP2 with recombinant antibody fragments may provide a therapeutically viable approach for treating ovarian cancers that express high levels of EMP2, which represents the majority of serous and endometrioid ovarian tumors .

What methodologies can be employed to evaluate EMP2 as a therapeutic target in different cancer types?

To comprehensively evaluate EMP2 as a therapeutic target, researchers should employ a multi-faceted approach:

Target Validation Studies:

  • Expression Analysis:

    • Tissue microarray (TMA) analysis across cancer subtypes and stages

    • Correlation of expression with clinical outcomes

    • Single-cell RNA sequencing to identify cellular heterogeneity

  • Functional Validation:

    • Genetic manipulation (overexpression/knockdown) followed by phenotypic assays

    • Rescue experiments to confirm specificity

    • Pathway analysis to identify mechanism of action

Therapeutic Development Pipeline:

  • Target Engagement Studies:

    • Binding affinity measurements (SPR, BLI)

    • Cellular target engagement assays

    • Competitive binding studies

  • Efficacy Assessment:

    • In vitro cytotoxicity across cell line panels

    • 3D organoid models for more physiologically relevant testing

    • Multiple xenograft models representing different cancer subtypes

    • Patient-derived xenografts to capture tumor heterogeneity

  • Mechanism of Action Studies:

    • Detailed signaling pathway analysis

    • Combination studies with standard therapies

    • Resistance mechanism exploration

  • Safety Assessment:

    • Expression profiling in normal tissues

    • Toxicity studies in appropriate animal models

    • Off-target effect evaluation

The comprehensive evaluation should include correlation of response with biomarkers (particularly EMP2 expression levels) to define the patient population most likely to benefit from EMP2-targeted therapies .

What are the potential mechanisms of resistance to EMP2-targeted therapies that researchers should investigate?

While EMP2-targeted therapies show promise, researchers should proactively investigate potential resistance mechanisms:

Primary Resistance Mechanisms:

  • Target Alteration:

    • Mutations in EMP2 that affect antibody binding

    • Alternative splicing generating isoforms with altered epitope accessibility

    • Post-translational modifications affecting target recognition

  • Target Expression:

    • Heterogeneous EMP2 expression within tumors

    • Dynamic regulation of EMP2 expression under therapy pressure

    • Epigenetic silencing of EMP2 in response to selection pressure

Acquired Resistance Mechanisms:

  • Pathway Redundancy:

    • Activation of alternative integrin signaling complexes

    • Compensatory upregulation of other tetraspan proteins

    • Bypass activation of downstream signaling (FAK/Src) via alternative routes

  • Microenvironment Adaptations:

    • Changes in extracellular matrix composition

    • Altered tumor-stromal interactions

    • Recruitment of supportive immune cell populations

  • Cellular Adaptations:

    • Phenotypic shifts (epithelial-mesenchymal transition)

    • Metabolic reprogramming

    • Selection of pre-existing resistant subclones

Research approaches should include the development of resistant cell lines through chronic exposure to EMP2-targeted agents, genomic and proteomic profiling of resistant models, and clinical correlation studies when possible. Combination strategies targeting both EMP2 and potential resistance pathways should be explored preemptively to develop more durable therapeutic approaches .

What cutting-edge techniques are available for studying EMP2 protein-protein interactions in the cell membrane?

Advanced methodologies for investigating EMP2 protein-protein interactions include:

Proximity-Based Approaches:

  • BioID or TurboID:

    • Fusion of EMP2 with a promiscuous biotin ligase

    • Identification of proteins in close proximity through biotinylation

    • Mass spectrometry analysis of biotinylated proteins

    • Advantage: Captures transient interactions in living cells

  • APEX2 Proximity Labeling:

    • Similar principle using peroxidase-catalyzed biotinylation

    • Higher spatial and temporal resolution than BioID

Fluorescence-Based Methods:

  • FRET (Förster Resonance Energy Transfer):

    • Measures energy transfer between fluorophore-tagged proteins

    • Can detect interactions at <10 nm distance

    • Live-cell monitoring of dynamic interactions

  • FLIM (Fluorescence Lifetime Imaging Microscopy):

    • Measures changes in fluorescence lifetime upon interaction

    • Less susceptible to concentration artifacts than intensity-based FRET

  • Single-Molecule Tracking:

    • Visualizes individual EMP2 molecules in the membrane

    • Analysis of diffusion dynamics and co-tracking with potential partners

    • Reveals membrane microdomain organization

Biochemical Approaches:

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Chemical cross-linking of interacting proteins

    • Mass spectrometry identification of cross-linked peptides

    • Provides structural information about interaction interfaces

  • Native Mass Spectrometry:

    • Analysis of intact membrane protein complexes

    • Preserves non-covalent interactions

    • Requires specialized membrane protein extraction techniques

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps regions of protein-protein interaction

    • Identifies conformational changes upon binding

These advanced techniques can help elucidate the complex protein interaction network of EMP2 in the membrane, providing insights into its roles in integrin clustering, signaling complex formation, and membrane microdomain organization .

How can researchers effectively design studies to distinguish between correlation and causation in EMP2-associated cancer phenotypes?

Distinguishing correlation from causation in EMP2 research requires rigorous experimental design:

Establishing Causality Framework:

  • Temporal Precedence:

    • Inducible expression systems to demonstrate EMP2 changes precede phenotypic changes

    • Time-course experiments tracking EMP2 expression and activation of downstream pathways

    • Pulse-chase studies of signaling dynamics

  • Dose-Dependence:

    • Titrated expression systems with varying EMP2 levels

    • Correlation of expression magnitude with phenotypic intensity

    • Threshold effect determination

  • Genetic Manipulation Approaches:

    • Loss-of-Function Studies:

      • CRISPR-Cas9 knockout (complete loss)

      • shRNA/siRNA knockdown (partial reduction)

      • Dominant-negative mutants (functional interference)

    • Gain-of-Function Studies:

      • Stable overexpression

      • Inducible expression systems

      • Expression of constitutively active variants

  • Rescue Experiments:

    • Re-expression of EMP2 in knockout models

    • Domain-specific mutants to identify critical functional regions

    • Expression of orthologous proteins to test functional conservation

  • Pathway Validation:

    • Pharmacological inhibition of proposed downstream effectors

    • Genetic manipulation of pathway components

    • Epistasis experiments to order the signaling cascade

Addressing Alternative Explanations:

  • Control for Confounding Factors:

    • Use of isogenic cell lines differing only in EMP2 status

    • Multiple independent cell models to ensure reproducibility

    • Comprehensive phenotypic assessment beyond the primary endpoint

  • Mechanistic Consistency:

    • Demonstration of the same mechanism across multiple model systems

    • Alignment of in vitro findings with in vivo observations

    • Correlation with human patient data

These approaches collectively strengthen causal inference in EMP2 research, allowing researchers to move beyond correlative observations to mechanistic understanding .

What statistical approaches are most appropriate for analyzing EMP2 expression data in relation to clinical outcomes?

Appropriate statistical methods for analyzing EMP2 expression in relation to clinical outcomes include:

Survival Analysis Techniques:

  • Kaplan-Meier Method with Log-Rank Test:

    • For comparing survival curves between high and low EMP2 expression groups

    • Requires dichotomization of EMP2 expression (high vs. low)

    • Methods for determining optimal cut points include:

      • Recursive partitioning

      • Regression trees

      • Plotting log-rank p-values versus hazard ratios

  • Cox Proportional Hazards Model:

    • For univariate and multivariate analysis of factors related to survival

    • Can handle EMP2 as a continuous variable without arbitrary cutoffs

    • Allows adjustment for other prognostic factors

    • Assumption verification using Schoenfeld, martingale, and dfbeta residuals

Expression Analysis Methods:

  • Non-Parametric Tests:

    • Mann-Whitney or Kruskal-Wallis rank sum tests for comparing EMP2 expression levels between different subgroups

    • Appropriate when expression data doesn't follow normal distribution

  • Correlation Analysis:

    • Spearman's rank correlation for non-parametric assessment of correlation between EMP2 expression and continuous clinical variables

    • Point-biserial correlation for relationship with binary outcomes

Multivariate Approaches:

  • Multiple Regression Models:

    • Linear regression for continuous outcomes

    • Logistic regression for binary outcomes

    • Accounts for multiple predictors simultaneously

  • Machine Learning Methods:

    • Random forests or support vector machines for complex pattern recognition

    • Cross-validation to ensure model generalizability

    • Feature importance analysis to assess EMP2's relative contribution

For TMA Analysis:

  • Pooling of spot expression levels using established criteria

  • Adjustment for intra-tumor heterogeneity

  • Validation in independent cohorts

How should researchers reconcile contradictory findings about EMP2 function across different experimental systems?

Reconciling contradictory EMP2 findings requires systematic analysis of experimental variables and biological context:

Analytical Framework:

  • Experimental System Comparison:

    • Cell Type Differences:

      • Tissue of origin (epithelial vs. non-epithelial)

      • Cancer vs. normal cells

      • Species differences (human vs. mouse models)

    • Experimental Conditions:

      • 2D vs. 3D culture systems

      • Presence of extracellular matrix components

      • Serum concentrations and growth factor availability

    • Manipulation Methods:

      • Transient vs. stable manipulation

      • Complete knockout vs. partial knockdown

      • Overexpression levels (physiological vs. supraphysiological)

  • Molecular Context Evaluation:

    • Expression Level of Interaction Partners:

      • Integrin expression profiles

      • FAK/Src pathway component status

      • Membrane microdomain composition

    • Cell Signaling Status:

      • Baseline activation of relevant pathways

      • Mutational status of key oncogenes/tumor suppressors

      • Activation state of compensatory mechanisms

  • Technical Considerations:

    • Antibody Specificity:

      • Epitope location and accessibility

      • Cross-reactivity with related proteins

      • Validation methods employed

    • Detection Methods:

      • Sensitivity thresholds

      • Dynamic range limitations

      • Temporal resolution differences

Resolution Strategies:

  • Direct Replication Studies:

    • Side-by-side comparison under identical conditions

    • Systematic variation of single parameters

    • Use of multiple detection methods

  • Context-Dependent Interpretation:

    • Acknowledge tissue-specific or condition-specific roles

    • Develop integrated models incorporating context-dependent functions

    • Identify molecular switches that determine functional outcomes

  • Meta-Analysis Approaches:

    • Systematic review of published literature

    • Formal meta-analysis where appropriate

    • Identification of consistent trends across studies

By applying this structured approach, researchers can transform seemingly contradictory findings into a more nuanced understanding of EMP2's context-dependent functions .

What are the most significant technical challenges in studying membrane proteins like EMP2, and how can they be overcome?

Membrane proteins like EMP2 present unique technical challenges that require specialized approaches:

Structural Analysis Challenges:

  • Protein Isolation Difficulties:

    • Hydrophobic transmembrane domains complicate extraction

    • Requirement for detergents that may disrupt native conformation

    • Low expression levels in natural systems

    Solutions:

    • Optimized detergent screens (mild detergents like DDM, LMNG)

    • Nanodiscs or SMALPs for near-native membrane environment

    • Overexpression systems with careful validation

  • Crystallization Barriers:

    • Conformational heterogeneity

    • Large hydrophobic surfaces

    • Dynamic nature of membrane proteins

    Solutions:

    • Lipidic cubic phase crystallization

    • Fusion protein approaches to increase soluble domains

    • Cryo-EM as an alternative to crystallography

    • Computational structural prediction with AlphaFold2

Functional Analysis Challenges:

  • Maintaining Native Environment:

    • Loss of function outside lipid bilayer context

    • Altered interaction dynamics in artificial systems

    • Disruption of membrane microdomains

    Solutions:

    • Live-cell imaging techniques

    • Reconstitution in artificial membrane systems

    • Native membrane isolation techniques

    • Proximity labeling in intact cells

  • Dynamic Protein Trafficking:

    • Rapid cycling between surface and intracellular compartments

    • Stimulus-dependent localization changes

    • Technical difficulty in distinguishing pools

    Solutions:

    • Pulse-chase labeling approaches

    • pH-sensitive fluorescent tags

    • Super-resolution microscopy

    • Selective surface biotinylation

Expression Manipulation Challenges:

  • Compensatory Mechanisms:

    • Upregulation of related proteins

    • Pathway rewiring after manipulation

    • Adaptation over experimental timeframes

    Solutions:

    • Acute manipulation systems (e.g., degrader approaches)

    • Combinatorial targeting of related proteins

    • Time-course studies to capture immediate effects

    • Inducible systems for temporal control

  • Off-Target Effects:

    • Disruption of membrane organization

    • Secondary effects on interacting partners

    • Altered cellular stress responses

    Solutions:

    • Multiple independent manipulation approaches

    • Careful control selection

    • Rescue experiments with resistant constructs

    • Domain-specific mutations rather than whole protein deletion

By applying these specialized approaches, researchers can overcome the inherent challenges of studying tetraspan membrane proteins like EMP2, generating more reliable and physiologically relevant data .

What emerging technologies hold the most promise for advancing our understanding of EMP2 biology?

Several cutting-edge technologies are poised to significantly advance EMP2 research:

Structural Biology Innovations:

  • Cryo-Electron Tomography:

    • Visualizes proteins in their native cellular environment

    • Potential to resolve EMP2-containing complexes in situ

    • Could reveal membrane microdomain organization

  • Integrative Structural Biology:

    • Combines multiple techniques (X-ray, NMR, cryo-EM)

    • AI-enhanced structure prediction (AlphaFold2/RoseTTAFold)

    • Could resolve full structure of EMP2 and its complexes

Single-Cell Technologies:

  • Single-Cell Multi-omics:

    • Combines transcriptomics, proteomics, and epigenomics

    • Reveals heterogeneity in EMP2 expression and function

    • Identifies rare cell populations with distinct EMP2 roles

  • Spatial Transcriptomics/Proteomics:

    • Maps EMP2 expression within tissue architecture

    • Reveals microenvironmental influences on EMP2 function

    • Correlates with cellular phenotypes in situ

Advanced Imaging Approaches:

  • Super-Resolution Live-Cell Imaging:

    • Nanoscale visualization of EMP2 dynamics

    • Tracks interaction with partners in real-time

    • Reveals membrane microdomain organization

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines molecular specificity with ultrastructural context

    • Could reveal EMP2's role in specialized membrane structures

Functional Genomics Tools:

  • CRISPR Screening Platforms:

    • Genome-wide or focused screens for synthetic interactions

    • Base editing for precise mutation introduction

    • CRISPRi/CRISPRa for reversible manipulation

  • Optogenetic/Chemogenetic Control:

    • Light or small molecule-inducible control of EMP2 function

    • Millisecond temporal resolution

    • Subcellular spatial precision

Therapeutic Development Platforms:

  • Proteolysis Targeting Chimeras (PROTACs):

    • Targeted degradation of EMP2 protein

    • More complete inhibition than antibody approaches

    • Potential to overcome resistance mechanisms

  • Advanced Antibody Engineering:

    • Bispecific antibodies targeting EMP2 and immune effectors

    • Antibody-drug conjugates for targeted delivery

    • Conditionally active antibodies for tumor specificity

These emerging technologies promise to overcome current limitations in EMP2 research, providing unprecedented insights into its structure, dynamics, interactions, and functions in both normal and disease states .

How might research into EMP2's role in non-cancer contexts enhance our understanding of its functions in malignancy?

Investigating EMP2 in non-cancer contexts can provide valuable insights that inform cancer research:

Developmental Biology Perspectives:

  • Embryonic Development:

    • EMP2's role in tissue morphogenesis

    • Regulation during epithelial differentiation

    • Potential recapitulation of developmental programs in cancer

  • Stem Cell Biology:

    • Function in stem cell niches

    • Role in differentiation vs. self-renewal decisions

    • Parallels to cancer stem cell biology

Normal Tissue Homeostasis:

  • Epithelial Barrier Function:

    • Contribution to tight junction formation

    • Regulation of epithelial permeability

    • Relevance to epithelial-mesenchymal transition in cancer

  • Cellular Stress Responses:

    • Role in adapting to microenvironmental stresses

    • Involvement in wound healing processes

    • Connection to stress adaptation in tumors

Immunological Contexts:

  • Immune Cell Function:

    • Expression and function in immune cell subsets

    • Role in immune cell migration and adhesion

    • Implications for tumor-immune interactions

  • Inflammatory Conditions:

    • Regulation during acute and chronic inflammation

    • Contribution to resolution vs. persistence of inflammation

    • Links between inflammation and cancer progression

Other Pathological States:

  • Proliferative Vitreoretinopathy:

    • EMP2's role in collagen-gel contraction through FAK activation

    • De-differentiation of retinal pigment epithelium

    • Parallels to invasive behavior in cancer

  • Fibrotic Disorders:

    • Potential involvement in fibroblast activation

    • Contribution to extracellular matrix remodeling

    • Shared mechanisms with desmoplastic reaction in tumors

Cross-disciplinary research approaches examining EMP2 across these contexts can reveal fundamental biological principles that:

  • Identify conserved vs. context-specific functions

  • Illuminate regulation mechanisms that may be dysregulated in cancer

  • Reveal potential vulnerabilities for therapeutic targeting

  • Provide biomarkers for early disease detection

  • Suggest novel combination therapeutic strategies

This broader perspective on EMP2 biology will likely yield unexpected insights that advance both basic science understanding and clinical applications in cancer .

What are the most important unanswered questions about EMP2 that researchers should prioritize investigating?

Critical knowledge gaps in EMP2 biology that warrant priority investigation include:

Fundamental Biological Questions:

  • Structural Determinants of Function:

    • Complete 3D structure of full-length EMP2

    • Identification of critical domains for specific functions

    • Structural changes during activation/signaling

  • Regulation Mechanisms:

    • Transcriptional control in different contexts

    • Post-translational modifications affecting function

    • Trafficking pathways and membrane localization determinants

    • Protein turnover and degradation mechanisms

  • Comprehensive Interactome:

    • Complete protein interaction network across cell types

    • Dynamic changes in interactions under different conditions

    • Hierarchical importance of different interaction partners

Cancer Biology Priorities:

  • Oncogenic Mechanisms:

    • Precise signaling pathways mediating cancer-promoting effects

    • Role in metabolic reprogramming of cancer cells

    • Contribution to therapeutic resistance mechanisms

    • Function in metastatic cascade steps

  • Tumor Microenvironment Interactions:

    • Impact on stromal cell recruitment and activation

    • Influence on immune cell function and infiltration

    • Role in extracellular matrix remodeling

    • Contribution to tumor hypoxia responses

  • Clinical Relevance Validation:

    • Prognostic significance across diverse cancer types and stages

    • Predictive value for specific therapeutic approaches

    • Potential as a circulating biomarker for early detection

Therapeutic Development Priorities:

  • Target Validation:

    • Comprehensive safety assessment across normal tissues

    • Genetic validation through conditional knockout models

    • Therapeutic window definition and optimization

  • Optimal Targeting Strategies:

    • Comparative assessment of antibody vs. small molecule vs. degrader approaches

    • Identification of synergistic combination regimens

    • Development of predictive biomarkers for patient selection

    • Mechanisms of primary and acquired resistance

  • Translational Barriers:

    • Optimization of clinical-grade therapeutic agents

    • Development of companion diagnostics

    • Patient stratification approaches

    • Rational combination strategies

Addressing these priority questions will accelerate both fundamental understanding of EMP2 biology and clinical translation of EMP2-targeted therapeutic approaches. A multidisciplinary approach combining structural biology, cell biology, systems biology, and translational research will be essential to efficiently advance this research agenda .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.