Recombinant Human Estradiol 17-beta-dehydrogenase 12 (HSD17B12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its use.
Synonyms
HSD17B12; SDR12C1; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12; Short chain dehydrogenase/reductase family 12C member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
HSD17B12
Target Protein Sequence
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTD GIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKT GLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERS KGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLA KIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKS TRAHYLKKTKKN
Uniprot No.

Target Background

Function

Recombinant Human Estradiol 17-beta-dehydrogenase 12 (HSD17B12) catalyzes the second step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme facilitates the addition of two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. HSD17B12 exhibits 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in each elongation cycle. This function contributes to the production of VLCFAs of varying chain lengths, which serve as precursors for membrane lipids and lipid mediators. Additionally, HSD17B12 may catalyze estrone (E1) conversion to estradiol (E2), playing a role in estrogen biosynthesis.

Gene References Into Functions
  1. HSD17B12 expression increased with ovarian cancer severity, mirroring COX-2 expression. This suggests HSD17B12 involvement in arachidonic acid (AA) production and increased prostaglandin production during cancer progression. PMID: 29324448
  2. Associations were found between CpG sites and patient sex, including methylation in CASP6 (potentially responsive to estradiol) and HSD17B12 (encoding a sex steroid hormone). PMID: 24058506
  3. Evidence suggested 46,XY Disorders of Sex Development (DSD) due to 17β-HSD3 deficiency, linked to an homozygous mutation (IVS3 -1 G>C or c.326-1G>C) in the 17β-HSD3 gene. PMID: 23435447
  4. HSD17B12 overexpression correlates with poor survival in ovarian cancer patients, facilitating tumor progression. PMID: 22903146
  5. High HSD17B12 expression is associated with neoplasms. PMID: 21409596
  6. 17β-HSD12 is a major estrogenic 17β-HSD responsible for E1 to E2 conversion in women. PMID: 16166196
  7. Studies have mapped the location of 17β-hydroxysteroid dehydrogenase type 12 throughout the human body. PMID: 16621523
  8. 17β-HSD12 is not directly involved in intratumoral estradiol biosynthesis in human breast carcinoma but is correlated with VLCFA production and tumor progression. PMID: 19190350
  9. Studies compared the activity and expression levels of estrogenic 17β-HSDs (types 1, 7, and 12) in preadipocytes before and after differentiation. PMID: 19429442
  10. Variants of 17β-HSD types 7 and 12 showed no difference in catalytic properties compared to wild-type enzymes; however, variants p.Glu77Gly and p.Lys183Arg in 17β-HSD type 5 exhibited slightly reduced activity. PMID: 19460435
  11. SREBP-1 is a transcriptional regulator of human 17β-HSD12. PMID: 19533843
Database Links

HGNC: 18646

OMIM: 609574

KEGG: hsa:51144

STRING: 9606.ENSP00000278353

UniGene: Hs.132513

Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in most tissues tested. Highly expressed in the ovary and mammary. Expressed in platelets.

Q&A

What is HSD17B12 and what are its primary functions?

HSD17B12 belongs to the hydroxysteroid 17-beta dehydrogenase family of enzymes. While these enzymes are traditionally associated with sex steroid metabolism through the catalysis of conversions between 17-keto and 17-hydroxysteroids, HSD17B12 has been identified to have a crucial role in lipid metabolism . Current research indicates that HSD17B12 is primarily involved in the elongation of very long chain fatty acids (VLCFAs), with particular importance in the production of arachidonic acid . This enzyme demonstrates a universal expression pattern in both human and mouse tissues, underscoring its fundamental metabolic importance .

What experimental models are most effective for studying HSD17B12?

The most effective experimental models for studying HSD17B12 function are conditional knockout mice systems. Previous studies have established that complete global knockout of HSD17B12 is embryonically lethal, highlighting its essential role during development . To overcome this limitation, researchers have successfully employed conditional knockout models using the Cre-loxP system. Specifically, mice with exon 2 of the Hsd17b12 gene flanked by loxP sites can be crossed with mice expressing tamoxifen-inducible Cre recombinase under various promoters . This approach allows for:

  • Temporal control through tamoxifen administration (typically at 8 weeks of age)

  • Tissue-specific deletion when using tissue-specific promoters driving Cre expression

  • Global deletion when using ubiquitous promoters like Rosa26

These models permit the study of HSD17B12 function in adult mice while avoiding the developmental lethality associated with constitutive knockout.

What methods can accurately measure HSD17B12 enzymatic activity?

For measuring HSD17B12 enzymatic activity in research settings, multiple complementary approaches should be employed:

  • Direct enzyme activity assays: Using purified recombinant HSD17B12 or tissue extracts with appropriate substrates (estrone or fatty acyl-CoAs) and monitoring product formation through HPLC or mass spectrometry.

  • Fatty acid elongation assessment: Measuring the conversion of shorter chain fatty acids to longer chain fatty acids, particularly monitoring the production of arachidonic acid from precursors.

  • Lipidomic profiling: As demonstrated in research by Mäkelä et al., mass spectrometry-based lipidomic analysis can reveal shifts in lipid species that indirectly reflect HSD17B12 activity . This approach can detect alterations in ceramides and other complex lipids containing various fatty acid chain lengths.

How does HSD17B12 deficiency affect metabolic homeostasis in adult organisms?

HSD17B12 deficiency in adult mice leads to profound metabolic disruption. In tamoxifen-induced global knockout models (HSD17B12cKO), researchers observed:

  • 20% reduction in body weight within 6 days of gene inactivation

  • Drastic reduction in both white adipose tissue (83% in males, 75% in females) and brown adipose tissue (65% in males, 60% in females)

  • Significantly reduced food intake (44%) and water consumption (65%)

  • Development of microvesicular hepatic steatosis

  • Increased serum alanine aminotransferase levels (4.6-fold in males, 7.7-fold in females), indicating liver toxicity

These effects occur despite no observable differences in motor activity between knockout and control mice . The metabolic disruption appears to be systemic rather than confined to specific tissues, as adipocyte-specific knockout models did not recapitulate the severe phenotype .

What changes in lipid profiles are observed following HSD17B12 knockout?

Comprehensive lipidomic analysis of serum from HSD17B12cKO mice revealed complex alterations in lipid profiles:

  • Marked reduction in multiple lipid classes, with triacylglycerols (TAGs) showing the most severe decrease

  • Significant decreases in ceramides (CERs), lysophosphatidylethanolamines (LPEs), lysophosphatidylcholines (LPCs), phosphatidylcholines (PCs), sphingomyelins (SMs), and lactosylceramides (LCERs)

  • 1.39-fold increase in dihydroceramides (DCERs), notable as the only lipid class to accumulate during weight loss

  • 2.6-fold increase in the DCER-to-CER ratio

  • Accumulation of ceramides, dihydroceramides, hexosylceramides, and lactosylceramides with shorter fatty acid side chains (especially C14 and C16)

  • Reduced relative amounts of fatty acids with longer chain lengths (C18:0, C20:0, C22:0, C22:1, C24:0, and C24:1)

These findings provide strong evidence for HSD17B12's role in fatty acid elongation, as the pattern shows accumulation of shorter-chain fatty acids and reduction in longer-chain fatty acids in complex lipids.

What is the relationship between HSD17B12 deficiency and inflammatory responses?

HSD17B12 deficiency triggers significant systemic inflammation. Serum cytokine analysis in HSD17B12cKO mice revealed:

CytokineMale ResponseFemale Response
IL-68.02-fold increase35.3-fold increase
IL-175.75-fold increase4.14-fold increase
G-CSF2.30-fold increase12.6-fold increase

Table: Selected inflammatory cytokines significantly elevated in HSD17B12cKO mice compared to controls

Additionally, some cytokines showed sex-specific alterations:

  • Males showed decreased IL-1α, IL-5, and IP-10 levels

  • Females showed decreased IFN-γ and MIP-1α but increased KC levels

These inflammatory changes correlate with observed sickness behavior in the knockout mice, including piloerection, social isolation, partially closed eyelids, unresponsiveness, and snout grooming . The mechanism connecting lipid metabolism disruption to inflammation remains an important research question.

How should researchers design conditional knockout experiments for HSD17B12?

Based on published research methodologies, the optimal approach for designing conditional knockout experiments for HSD17B12 includes:

  • Gene targeting strategy: Focus on exon 2 of the Hsd17b12 gene for flanking with loxP sites, as this has been validated to produce effective knockout when excised .

  • Cre-driver selection:

    • For global inducible knockout: Use Rosa26-driven tamoxifen-inducible Cre (HSD17B12cKOrosa26)

    • For tissue-specific studies: Use appropriate tissue-specific promoters, such as adiponectin promoter for adipocyte-specific deletion (HSD17B12cKOadipoq)

  • Induction protocol: Administer tamoxifen at 8 weeks of age, allowing for normal development before studying adult functions .

  • Monitoring timeline: Plan for rapid phenotype development, with significant changes observable within 6 days post-induction .

  • Controls: Include both Cre-negative littermates treated with tamoxifen and Cre-positive mice without tamoxifen treatment to control for potential Cre toxicity or tamoxifen effects .

What lipidomic approaches are most informative for analyzing HSD17B12 function?

Based on published methodologies, a comprehensive lipidomic approach should include:

This approach can identify changes across more than 800 lipid metabolites spanning 13 different lipid classes, providing comprehensive insight into HSD17B12's role in lipid metabolism .

How can researchers distinguish between primary and secondary effects of HSD17B12 manipulation?

To distinguish between primary and secondary effects of HSD17B12 manipulation, researchers should:

  • Implement time-course experiments: Analyze changes at multiple time points following knockout induction to determine the sequence of events.

  • Utilize tissue-specific knockouts: Compare phenotypes between global and tissue-specific knockout models to identify tissue-autonomous effects .

  • Perform transcriptomic analysis: Measure expression changes in metabolic pathways to identify compensatory responses, as demonstrated in liver samples from HSD17B12cKO mice:

    • Decreased expression of de novo lipogenesis genes (Acaca, Fasn, Scd1)

    • Increased expression of gluconeogenesis genes (Pepck)

    • No change in fatty acid uptake genes (Cd36, Fatp2)

  • Conduct rescue experiments: Attempt to rescue phenotypes through targeted interventions, such as:

    • Providing specific fatty acid supplements

    • Administering anti-inflammatory treatments

    • Tissue-specific re-expression of HSD17B12

What are the critical quality control measures for recombinant HSD17B12 production?

When producing recombinant HSD17B12 for research, critical quality control measures should include:

  • Verification of sequence integrity: Confirm the absence of mutations through sequencing.

  • Assessment of purity: Use SDS-PAGE and Western blotting to verify protein purity and identity.

  • Enzymatic activity validation: Test the recombinant protein's ability to:

    • Catalyze the conversion between 17-keto and 17-hydroxysteroids

    • Participate in fatty acid elongation reactions

  • Structural integrity analysis: Employ circular dichroism or thermal shift assays to confirm proper protein folding.

  • Endotoxin testing: Ensure preparations are endotoxin-free, particularly for in vivo applications.

How do sex differences influence HSD17B12 function and research outcomes?

The search results indicate important sex differences in HSD17B12 function that researchers should consider:

  • Liver phenotype variations: Female HSD17B12cKO mice showed more pronounced hepatic changes than males, with:

    • Greater fat accumulation in the liver

    • Higher serum ALT levels (7.7-fold increase in females vs. 4.6-fold in males)

    • More evident microvesicular steatosis

    • Higher trend of apoptotic cells

  • Inflammatory response differences: The cytokine profile showed sex-specific patterns:

    • Females had dramatically higher G-CSF increases (12.6-fold vs. 2.3-fold in males)

    • IL-6 increase was more pronounced in females (35.3-fold vs. 8.02-fold in males)

    • Different patterns of decreased cytokines between sexes

These findings underscore the importance of including both sexes in HSD17B12 research and analyzing data in a sex-specific manner.

What are common challenges in HSD17B12 functional studies and how can they be addressed?

Researchers studying HSD17B12 function commonly encounter these challenges:

  • Early lethality in knockout models:

    • Challenge: Global knockout is embryonically lethal

    • Solution: Use inducible systems that allow for temporal control of gene deletion

  • Rapid deterioration of animal health after induction:

    • Challenge: HSD17B12cKO mice show severe weight loss and sickness behavior within 6 days

    • Solution: Design studies with appropriate time points and ethical endpoints; consider partial knockdown approaches for longer-term studies

  • Complex metabolic effects:

    • Challenge: Distinguishing direct enzyme effects from secondary metabolic adaptations

    • Solution: Perform comprehensive multi-omics analysis including lipidomics, transcriptomics, and proteomics to track sequential changes

  • Functional redundancy:

    • Challenge: Other enzymes may partially compensate for HSD17B12 loss

    • Solution: Consider combinatorial knockouts or inhibitor studies targeting multiple related enzymes

How can researchers reconcile contradictory findings in HSD17B12 research?

When encountering contradictory findings in HSD17B12 research, consider these methodological approaches:

  • Evaluate model differences: Different species, cell types, or knockout strategies may yield varying results. Compare tamoxifen-inducible systems with constitutive knockouts or RNAi approaches.

  • Consider developmental timing: HSD17B12's role may differ during development versus adulthood, as evidenced by embryonic lethality of constitutive knockout versus metabolic effects in adult-induced knockouts .

  • Examine tissue-specific effects: The search results indicate that while global HSD17B12cKO causes severe phenotypes, adipocyte-specific knockout does not replicate these effects, suggesting tissue-specific roles .

  • Assess experimental conditions: Environmental factors, diet, stress, and housing conditions may influence phenotypes, particularly for metabolic studies.

  • Analyze sex differences: As demonstrated in the research, male and female mice show distinct responses to HSD17B12 knockout, with females experiencing more severe liver phenotypes and different inflammatory profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.