Recombinant Human Etoposide-induced protein 2.4 homolog (EI24)

What is the molecular structure of EI24?

EI24 is a transmembrane protein with a full amino acid sequence of 340 residues in humans. The protein contains multiple transmembrane domains, with the TM34 domain serving as a stress-sensing region. The C-terminus of EI24 is particularly important for binding to interaction partners like IRE1. The complete amino acid sequence begins with MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRR and continues through the protein's transmembrane and functional domains .

When working with recombinant EI24, researchers typically use proteins with tags (such as the N-terminal 10xHis-tag) to facilitate purification and detection. Storage recommendations include maintaining the protein at -20°C or -80°C, with shelf life typically around 6 months for liquid forms and 12 months for lyophilized preparations .

How does EI24 contribute to cellular homeostasis?

EI24 serves as a critical regulator of cellular homeostasis through multiple mechanisms:

Loss of EI24 function disrupts these homeostatic mechanisms, potentially leading to cellular dysfunction and death, highlighting its importance in maintaining normal cellular function.

How does EI24 regulate pancreatic β cell function and diabetes pathology?

EI24 plays a crucial role in pancreatic β cell function through its regulation of calcium homeostasis. Research demonstrates that:

• EI24 levels are decreased in β cells of diabetic individuals and in diabetic animal models .

• EI24 binds to ATP2a2 through its ATP2a2-interacting region (AIR, residues 293-299), activating this calcium pump .

• Loss of EI24 leads to:

  • Inactivation of ATP2a2

  • Disruption of calcium homeostasis

  • Deactivation of the calcium/calmodulin-dependent protein kinase kinase 2 (CAMKK2)-AMP-activated protein kinase (AMPK) pathway

These disruptions contribute to impaired β cell function and glucose intolerance. Notably, elevation of calcium concentration in the endoplasmic reticulum or agonist-induced AMPK activation can rescue pancreatic β cell survival and improve glucose tolerance in EI24 knockout mice .

For researchers investigating diabetes treatments, targeting the EI24-ATP2a2 interaction represents a promising approach to protect pancreatic β cells and improve glucose homeostasis in diabetic models.

What is the mechanism by which EI24 coordinates ER stress response?

EI24 functions as a sophisticated coordinator of ER stress response through a dual mechanism involving both IRE1-mediated UPR signaling and calcium homeostasis:

• IRE1 Regulation:

  • Under normal conditions, EI24 binds to the kinase domain of IRE1 through its C-terminus, inhibiting IRE1 activation .

  • The TM34 domain of EI24 functions as a stress-sensing domain. Upon ER stress, EI24 disassociates from IRE1, allowing UPR activation .

  • When the TM34 domain is deleted (ΔTM34 mutant), EI24 persistently interacts with IRE1 regardless of ER stress status, preventing proper stress response .

• Calcium Homeostasis Maintenance:

  • During ER stress, after dissociating from IRE1, EI24 switches to bind IP3R1 (inositol 1,4,5-trisphosphate receptor type 1), preventing ER calcium depletion .

  • This calcium regulation is essential for cell survival during stress conditions.

This coordinated response mechanism allows cells to adapt to ER stress conditions. When EI24 is knocked out, cells fail to adapt to ER stress, leading to increased apoptosis . This suggests that EI24 functions as a novel anti-apoptotic factor implicated in ER stress signaling.

How does EI24 influence cancer cell proliferation and chemoresistance?

EI24 demonstrates significant tumor-suppressive properties in cancer models, particularly in esophageal squamous cell carcinoma (ESCC):

• Cell Proliferation Effects:

  • EI24 overexpression significantly decreases cell proliferation activity and colony-forming potential in ESCC cell lines (EC9706 and EC109) .

  • Conversely, EI24 silencing via CRISPR-Cas9 technology markedly increases cell proliferation and colony formation in KYSE150 and TE-1 cells .

  • In vivo studies confirm these findings, with EI24-knockout tumors growing significantly faster than control tumors in xenograft models .

• Cell Cycle Regulation:

  • Ectopic expression of EI24 increases the percentage of cells in G1 phase and decreases cells in S phase .

  • EI24 knockdown produces the opposite effect, decreasing G1 phase cells and increasing S phase cells .

  • These changes correlate with altered expression of cell cycle regulators including CDK2, CDK4, and cyclin D1, which decrease with EI24 overexpression .

• Chemoresistance Modulation:

  • EI24-knockdown ESCC cells display decreased sensitivity to various chemotherapeutic agents (5-FU, ADR, VCR, and CDDP) .

  • Overexpression of EI24 distinctly reduces cell viability when treated with these chemotherapeutic agents .

• Molecular Pathways:

  • Microarray and bioinformatic analyses reveal that EI24 interacts with the acute phase response signaling pathway and IL-1 signaling cascade .

  • EI24 silencing leads to activation of the IL-1 signaling pathway and upregulation of NF-κB and related genes .

  • EI24 can suppress NF-κB activity by interacting with TNFR-associated factors 2/5 (TRAF2/5), causing their lysosome-dependent degradation .

These findings suggest that EI24 represents a potential therapeutic target for ESCC treatment, with particular relevance to overcoming chemoresistance.

What are the optimal techniques for manipulating EI24 expression in experimental models?

Based on successful methodologies reported in the research literature, the following approaches have proven effective for manipulating EI24 expression:

• EI24 Knockout Models:

  • CRISPR-Cas9 Technology: Successfully used to generate stable EI24-knockout cell lines (e.g., KYSE150 and TE-1 cells) . This approach requires:

    • Design of EI24-specific sgRNA

    • Cas9 expression system

    • Verification of knockout efficiency via Western blot and qRT-PCR

  • Cre-LoxP System: Effective for generating pancreatic β cell-specific EI24 knockout mice, allowing tissue-specific study of EI24 function .

• EI24 Overexpression Models:

  • Lentiviral Vector Transfection: Successfully used to establish stable EI24-overexpressing cell lines (e.g., EC9706 and EC109) .

  • Verification protocols should include:

    • Western blot analysis

    • qRT-PCR assessment

    • Localization confirmation via immunofluorescence

• Domain-Specific Mutants:

  • For mechanistic studies, targeted mutations have proven valuable:

    • ΔTM34 (stress-sensing domain deletion): Creates persistent EI24-IRE1 binding regardless of ER stress

    • ΔC (C-terminus deletion): Eliminates IRE1 binding capacity

    • These constructs help dissect the functional domains of EI24

When implementing these techniques, researchers should incorporate appropriate controls (e.g., EI24-NC negative control constructs) and verify correct subcellular localization of the manipulated EI24 protein or its mutants .

What assays are most effective for studying EI24's impact on cell viability and stress response?

To comprehensively evaluate EI24's effects on cell viability and stress response, researchers should consider the following validated assay approaches:

• Cell Proliferation and Viability Assays:

  • MTT Assay: Effectively demonstrates changes in cell proliferation activity following EI24 manipulation .

  • Colony Formation Assay: Provides clear visualization of long-term effects on cellular growth and survival capacity .

  • In vivo Xenograft Models: For tumorigenic cell lines, xenograft studies in nude mice can confirm in vitro findings and assess tumor weight and growth curves .

• Cell Cycle Analysis:

  • Flow Cytometry: Enables quantification of cell cycle distribution (G1, S, G2/M phases), revealing how EI24 affects cell cycle progression .

  • Western Blot Analysis of Cell Cycle Regulators: Assessment of CDK2, CDK4, and cyclin D1 expression correlates with observed cell cycle effects .

• ER Stress Response Evaluation:

  • IRE1 Activation Assays: Monitor phosphorylation status and downstream signaling .

  • Protein-Protein Interaction Studies: Co-immunoprecipitation to assess EI24 binding to IRE1 or IP3R1 under various stress conditions .

  • Calcium Homeostasis Measurement: Fluorescent calcium indicators to monitor changes in ER calcium levels .

• Drug Sensitivity Testing:

  • CCK-8 Assays: To measure changes in cell viability in response to chemotherapeutic agents across various concentrations .

  • Dose-Response Curves: For determining IC50 values and quantifying changes in drug sensitivity .

• Molecular Pathway Analysis:

  • Microarray Experimentation: For broad transcriptional profiling .

  • Bioinformatic Analysis: Using tools like IPA (Ingenuity Pathway Analysis) software to identify affected canonical pathways .

  • qRT-PCR Validation: To confirm expression changes in key pathway components .

When designing these experiments, researchers should include appropriate time points to capture both immediate and delayed effects of EI24 manipulation, particularly when studying stress responses that may evolve over time.

How can researchers effectively analyze EI24's role in calcium homeostasis?

To thoroughly investigate EI24's role in calcium homeostasis, researchers should employ a multi-faceted experimental approach:

• Interaction Studies with Calcium Regulators:

  • Co-immunoprecipitation assays to confirm binding between EI24 and calcium regulatory proteins (e.g., ATP2a2, IP3R1) .

  • Mapping studies to identify specific interaction domains, such as the ATP2a2-interacting region (AIR, residues 293-299) .

  • Mutagenesis of key interaction residues to confirm functional significance.

• Calcium Flux Measurements:

  • Live-cell calcium imaging using fluorescent calcium indicators to monitor cytosolic and ER calcium levels.

  • Measurement of calcium ATPase activity in cells with manipulated EI24 levels to directly assess ATP2a2 function .

  • ER calcium depletion assays to evaluate the protective effect of EI24 during stress conditions .

• Downstream Signaling Pathway Assessment:

  • Analysis of calcium-dependent CAMKK2-AMPK pathway activation through phosphorylation status .

  • Rescue experiments using calcium concentration elevation in the ER or agonist-induced AMPK activation to confirm pathway involvement .

• Tissue-Specific Analysis in Disease Models:

  • Comparison of pancreatic β cell calcium handling between wild-type and EI24 knockout models under normal and diabetic conditions .

  • Assessment of glucose tolerance in animal models with manipulated EI24 expression to correlate calcium homeostasis with physiological outcomes .

• Structured Data Collection and Analysis:

This systematic approach will provide comprehensive insights into EI24's role in calcium homeostasis across different cellular contexts and stress conditions.

How should researchers interpret contradictory findings about EI24's role in different cellular contexts?

EI24 demonstrates context-dependent functions that may appear contradictory across different experimental systems. To properly interpret these findings:

• Consider Tissue-Specific Roles:

  • In pancreatic β cells, EI24 primarily functions to maintain calcium homeostasis through ATP2a2 regulation, with direct implications for diabetes pathophysiology .

  • In cancer cells, EI24 functions as a tumor suppressor by regulating cell cycle progression and chemosensitivity, with particular evidence in ESCC models .

  • These differing roles may reflect tissue-specific interaction partners or downstream effectors.

• Examine Stress-Dependent Functions:

  • Under normal conditions, EI24 binds to and inhibits IRE1 .

  • Under ER stress, EI24 switches binding partners from IRE1 to IP3R1, adopting a different functional role .

  • This stress-dependent switching explains seemingly contradictory observations in different stress states.

• Analyze Pathway Interactions:

  • EI24 interacts with multiple signaling pathways, including CAMKK2-AMPK, IRE1-UPR, and IL-1/NF-κB signaling .

  • Apparent contradictions may result from differential pathway activation across experimental systems.

  • Comprehensive pathway analysis using IPA or similar tools can help reconcile divergent findings .

• Methodological Approach to Resolving Contradictions:

  • Direct comparison experiments using identical methodologies across different cell types.

  • Domain-specific mutants (e.g., ΔTM34, ΔC) to isolate specific functions of EI24 .

  • Time-course studies to capture the dynamic nature of EI24's function, particularly during stress responses.

  • Integration of in vitro and in vivo data to establish physiological relevance of observed mechanisms.

When publishing seemingly contradictory results, researchers should clearly contextualize their findings within the specific experimental system used and avoid overgeneralizing to all cellular contexts.

What are the key challenges in translating EI24 research findings to therapeutic applications?

Translating EI24 research findings into therapeutic applications presents several significant challenges that researchers must address:

• Target Specificity Challenges:

  • EI24 interacts with multiple proteins (ATP2a2, IRE1, IP3R1) across different cellular contexts .

  • Designing therapeutics that modulate specific EI24 interactions without disrupting others requires detailed structural understanding of interaction interfaces.

  • The ATP2a2-interacting region (AIR, residues 293-299) offers one potential specific targeting site .

• Context-Dependent Function:

  • EI24's role shifts depending on cell type, stress conditions, and disease context .

  • Therapeutic approaches must account for these contextual differences to avoid unintended consequences.

  • For example, enhancing EI24 function may benefit pancreatic β cells in diabetes while also potentially affecting tumor suppression pathways in other tissues.

• Delivery and Expression Systems:

  • As a transmembrane protein localized to the ER, EI24 presents challenges for standard drug delivery approaches .

  • Cell-type specific delivery systems would be required for targeted therapeutic applications.

  • Gene therapy approaches using the knockout and overexpression systems validated in research settings could be adapted .

• Biomarker Development:

  • Establishing reliable biomarkers for EI24 pathway activity is essential for clinical translation.

  • Downstream effects on calcium homeostasis, UPR activation, or cell cycle regulation could serve as surrogate markers .

  • Validation of these markers in patient samples from relevant disease states (diabetes, cancer) is needed.

• Potential Therapeutic Strategies:

  • For diabetes applications: Small molecules that enhance EI24-ATP2a2 interaction to improve calcium homeostasis in β cells .

  • For cancer applications: Approaches to upregulate EI24 expression or activity to enhance chemosensitivity and reduce proliferation .

  • Peptide mimetics based on key interaction domains like the AIR region could provide specific modulatory effects .

Overcoming these challenges requires interdisciplinary collaboration between structural biologists, medicinal chemists, cell biologists, and clinicians to develop targeted approaches that leverage EI24's beneficial functions while minimizing potential side effects.

How can researchers standardize experimental approaches to study EI24 function?

To advance the field of EI24 research, standardization of experimental approaches is essential. The following framework provides guidance for comprehensive and reproducible EI24 research:

• Expression Manipulation Standards:

  • Knockout Models: Standardize CRISPR-Cas9 targeting sequences for consistent gene disruption .

  • Overexpression Systems: Establish consensus expression vectors with standardized promoters and tags .

  • Verification Protocols: Implement consistent validation using both protein (Western blot) and mRNA (qRT-PCR) detection methods .

• Functional Assessment Standardization:

• Experimental Controls and Conditions:

  • Include both negative controls (EI24-NC) and positive controls (known modulators of each pathway) .

  • Standardize stress induction protocols (timing, concentration) for ER stress experiments .

  • Establish time-course standards to capture dynamic responses, particularly for stress and signaling studies.

• Domain-Specific Analysis:

  • Include standardized domain mutants (ΔTM34, ΔC) in functional studies to dissect mechanism .

  • Develop consensus interaction mapping approaches for new binding partners.

• Data Reporting Requirements:

  • Report complete experimental conditions including cell passage number, reagent sources, and instrument settings.

  • Include raw data where possible, particularly for key functional assays.

  • Standardize statistical approaches for different experiment types.

• Translational Research Guidelines:

  • Establish minimum criteria for advancing findings from cell models to animal studies.

  • Define consensus disease models for studying EI24's role in diabetes and cancer .

By adopting these standardized approaches, researchers can generate more comparable data across studies, accelerating progress in understanding EI24's complex functions and potential therapeutic applications.

What novel therapeutic applications might emerge from targeting EI24 pathways?

Based on current understanding of EI24's functions, several promising therapeutic applications are emerging:

• Diabetes Management Approaches:

  • Development of small molecules that enhance EI24-ATP2a2 interaction could protect pancreatic β cells from stress-induced dysfunction .

  • Peptide mimetics based on the ATP2a2-interacting region (AIR, residues 293-299) could stabilize ATP2a2 activity in diabetic conditions .

  • AMPK activators could bypass the need for EI24 by directly activating the downstream CAMKK2-AMPK pathway, potentially preserving β cell function .

• Cancer Treatment Strategies:

  • EI24 expression status could serve as a biomarker for chemotherapy responsiveness, particularly in ESCC .

  • Drugs that upregulate EI24 expression might sensitize resistant tumors to existing chemotherapeutic agents (5-FU, ADR, VCR, and CDDP) .

  • Inhibitors of the IL-1/NF-κB pathway could potentially mimic the effects of EI24 in suppressing tumor progression .

• ER Stress-Related Disorders:

  • Modulation of EI24's stress-sensing function via the TM34 domain could provide new approaches to manage ER stress-related pathologies .

  • Stabilization of EI24-IP3R1 interaction during stress conditions might prevent pathological calcium depletion in various disease states .

• Combination Therapy Approaches:

  • In cancer treatment, combining EI24 modulators with conventional chemotherapy could enhance efficacy and reduce required dosages .

  • For metabolic disorders, targeting both EI24-ATP2a2 and downstream AMPK pathways might provide synergistic benefits .

These emerging therapeutic directions will require further validation through preclinical models and eventual clinical trials, but they represent promising avenues based on the molecular understanding of EI24's diverse functions.

How might advanced technologies enhance our understanding of EI24 biology?

Emerging technologies offer exciting opportunities to deepen our understanding of EI24 biology:

• Structural Biology Approaches:

  • Cryo-electron microscopy could reveal the three-dimensional structure of EI24 in its native membrane environment, particularly in complex with interaction partners like ATP2a2 or IRE1 .

  • Hydrogen-deuterium exchange mass spectrometry could map dynamic conformational changes that occur during stress responses.

  • X-ray crystallography of specific interaction domains (e.g., the AIR region) could guide rational drug design efforts .

• Advanced Genomic and Transcriptomic Technologies:

  • Single-cell RNA sequencing could reveal cell-type specific responses to EI24 manipulation across tissues.

  • CRISPR screens could identify synthetic lethal interactions with EI24, particularly in cancer contexts .

  • ChIP-seq approaches could elucidate potential transcriptional regulatory functions of EI24 or its downstream effectors.

• Live-Cell Imaging Innovations:

  • FRET-based biosensors could monitor real-time interactions between EI24 and its binding partners during stress responses .

  • Optogenetic approaches to manipulate EI24 function with spatial and temporal precision.

  • Super-resolution microscopy to visualize EI24's precise localization within ER subdomains.

• Systems Biology Integration:

  • Multi-omics integration (proteomics, metabolomics, transcriptomics) to comprehensively map EI24-dependent networks.

  • Mathematical modeling of EI24's role in calcium homeostasis and ER stress response to predict system-level outcomes.

  • Machine learning applications to identify patterns in EI24-dependent cellular responses across experimental conditions.

• Translational Research Technologies:

  • Patient-derived organoids to study EI24 function in human disease contexts.

  • Humanized mouse models to better recapitulate EI24's role in human physiology and pathology.

  • High-throughput drug screening platforms targeting specific EI24 interactions or functions.

These technological advances will allow researchers to move beyond current knowledge limitations and develop a more nuanced understanding of EI24's complex biology across cellular contexts and disease states.