Recombinant Human FAD-dependent oxidoreductase domain-containing protein 1 (FOXRED1)

Shipped with Ice Packs
In Stock

Description

Introduction to FOXRED1

Recombinant Human FAD-dependent oxidoreductase domain-containing protein 1 (FOXRED1), also known as H17 or FP634, is an enzyme encoded by the FOXRED1 gene in humans . It functions as an oxidoreductase and a complex I-specific molecular chaperone involved in the assembly and stabilization of NADH dehydrogenase (ubiquinone), also known as complex I . Complex I, situated in the mitochondrial inner membrane, represents the largest of the five complexes within the electron transport chain .

Gene and Protein Structure

The FOXRED1 gene is located on the q arm of chromosome 11 at position 14.2 and comprises 12 exons . This gene encodes a 53.8 kDa protein consisting of 486 amino acids . Alternative splicing of the FOXRED1 gene results in multiple transcript variants .

FOXRED1 contains an oxidoreductase FAD-binding domain and shares structural similarities with FAD-binding proteins such as dimethylglycine dehydrogenase, sarcosine dehydrogenase, L-pipecolic acid oxidase, peroxisomal sarcosine oxidase, and pyruvate dehydrogenase regulatory subunit . Research indicates that tyrosine residues Y410 and Y411 are potential sites for covalent attachment of FAD, and a phenyl moiety at position 359 is crucial for FOXRED1 function . Furthermore, FOXRED1 is a matrix-directed protein imported via a mitochondrial membrane potential, potentially involving a 23 amino acid N-terminal mitochondrial localization sequence that is cleaved upon entry .

Function of FOXRED1

The FOXRED1 gene encodes a mitochondrial enzyme that aids in the assembly and stabilization of NADH: ubiquinone oxidoreductase, a multi-subunit enzyme in the mitochondrial respiratory chain . NADH: ubiquinone oxidoreductase (complex I) participates in metabolite transport and ATP synthesis . Complex I facilitates electron transfer from NADH to ubiquinone (coenzyme Q), which is the initial step in the mitochondrial respiratory chain, leading to proton translocation across the inner mitochondrial membrane . FOXRED1 is an oxidoreductase and a complex I-specific molecular chaperone, playing a role in the mid-to-late stages of complex I intermediate assembly . It is thought to interact with core subunit NDUFS3 and accessory subunits NDUFA5, NDUFA10, NDUFB10, and NDUFS5 .

Clinical Significance

Mutations in FOXRED1 can lead to mitochondrial deficiencies and associated disorders, with manifestations ranging from lethal neonatal diseases to adult-onset neurodegenerative disorders . These phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson's disease . Pathogenic mutations in FOXRED1 include c.1054C>T; p.R352W, c.694C>T; p.Q232X, and c.1289A>G; p.N430S, which have been associated with symptoms like lactic acidosis, hypertrophic cardiomyopathy, and optic atrophy . Clinically, these variants are linked to Leigh syndrome and infantile-onset mitochondrial encephalopathy . Survival rates with FOXRED1 mutations appear higher compared to other complex I deficiencies, and overexpression of mutant forms can restore complex I activity, suggesting a degree of compensation for FOXRED1 activity .

FOXRED1 and Colorectal Cancer

FOXRED1 has been identified as an assembly factor that promotes the stability of mitochondrial Complex I (CI), and alterations in mitochondrial CI may contribute to tumorigenesis and metastasis . Immunohistochemistry studies on 145 colorectal cancer cases revealed that FOXRED1 is mainly located in the cytoplasm of colorectal cancer tissues and is significantly associated with histopathological grading, depth of invasion, lymph node metastasis, distant metastasis, and TNM stage . Patients with higher FOXRED1 expression exhibited higher 3-year survival rates, suggesting FOXRED1 as an independent prognostic factor for survival in colorectal cancer . Therefore, low FOXRED1 expression correlates with a poor prognosis, indicating that targeting this molecule could be a potential treatment strategy for colorectal cancer .

FOXRED1 in Mitochondrial Encephalopathy

Mutations in the FOXRED1 gene have been associated with severe neurodevelopmental delays, epilepsy, high lactic acid levels, and diffuse brain atrophy and polycystic encephalomalacia in early infancy . Reported pathogenic variants include missense, non-sense, frameshift, and splice variants, with c.1054C>T (p.R352W) and c.612_615dupAGTG (p.A206SfsX15) being more common . Loss of FOXRED1 function primarily reduces the amount of fully assembled complex I . Studies on fibroblast lines from FOXRED1-mutated patients indicate FOXRED1's involvement in the middle to late stages of complex I assembly .

A study demonstrated that FOXRED1 function likely involves the assembly of two flavoprotein-containing OXPHOS complexes (Complexes I and II) and is cell-type specific . For example, FOXRED1 is required for complex II assembly in myoblasts . Currently, there are no curative treatments available for FOXRED-1-related complex I deficiency patients, and most patients with this condition experience a progressive disease course, severe disability, and a poor quality of life despite palliative care .

FOXRED1 Mutation Effects on OXPHOS Complexes

A homozygous missense mutation, c.1308 G→A (p.V421M) in the FOXRED1 gene, has been identified as affecting oxidative phosphorylation (OXPHOS) complexes I and II . The FOXRED1 protein, which contains an FAD-dependent oxidoreductase domain, is believed to be required for the assembly of holocomplex I .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. Please specify your required tag type for preferential development.
Synonyms
FOXRED1; FP634; FAD-dependent oxidoreductase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FOXRED1
Target Protein Sequence
MIRRVLPHGMGRGLLTRRPGTRRGGFSLDWDGKVSEIKKKIKSILPGRSCDLLQDTSHLP PEHSDVVIVGGGVLGLSVAYWLKKLESRRGAIRVLVVERDHTYSQASTGLSVGGICQQFS LPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQ EGAKVSLMSPDQLRNKFPWINTEGVALASYGMEDEGWFDPWCLLQGLRRKVQSLGVLFCQ GEVTRFVSSSQRMLTTDDKAVVLKRIHEVHVKMDRSLEYQPVECAIVINAAGAWSAQIAA LAGVGEGPPGTLQGTKLPVEPRKRYVYVWHCPQGPGLETPLVADTSGAYFRREGLGSNYL GGRSPTEQEEPDPANLEVDHDFFQDKVWPHLALRVPAFETLKVQSAWAGYYDYNTFDQNG VVGPHPLVVNMYFATGFSGHGLQQAPGIGRAVAEMVLKGRFQTIDLSPFLFTRFYLGEKI QENNII
Uniprot No.

Target Background

Function
Essential for the assembly of the mitochondrial respiratory chain NADH dehydrogenase (Complex I). Plays a role in the mid-to-late stages of complex I assembly.
Gene References Into Functions
  1. Myoblast FOXRED1 depletion reduces fully assembled complexes I and II. FOXRED1 interacts with ~370 kDa and ~620 kDa ND1-containing subcomplexes; its activity is crucial for 550 kDa complex I subcomplex formation. PMID: 27215383
  2. FOXRED1 loss, combined with protein, choline, and/or folate deficiencies, depletes glutathione, dysregulates nitric oxide metabolism, and leads to peroxynitrite-mediated complex I inactivation. PMID: 26235939
  3. A FOXRED1 structural model reveals a large substrate-binding cavity and a potential oxygen-binding site. PMID: 25765152
  4. FOXRED1 is essential for efficient respiratory chain complex I assembly; mutations causing partial loss of function impair complex I biogenesis. PMID: 25678554
  5. FOXRED1 mutations are linked to complex I deficiency. PMID: 20818383
Database Links

HGNC: 26927

OMIM: 252010

KEGG: hsa:55572

STRING: 9606.ENSP00000263578

UniGene: Hs.317190

Involvement In Disease
Mitochondrial complex I deficiency (MT-C1D)
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the genetic and protein structure of FOXRED1?

The FOXRED1 gene is located on the q arm of chromosome 11 in position 14.2 (11q14.2) and consists of 12 exons . The gene produces a 53.8 kDa protein composed of 486 amino acids, with alternatively spliced transcript variants also observed .

The protein structure of FOXRED1 contains an oxidoreductase FAD-binding domain and shows homology to several FAD-binding proteins including dimethylglycine dehydrogenase, sarcosine dehydrogenase, L-pipecolic acid oxidase, peroxisomal sarcosine oxidase, and pyruvate dehydrogenase regulatory subunit . Researchers should note that structural similarities to sarcosine oxidase (MSOX) suggest that tyrosine residues Y410 and Y411 likely constitute the site of covalent attachment for FAD . Additionally, a phenyl moiety at position 359 appears critical for proper function of the protein .

When performing structural studies, protein modeling approaches using SWISS-MODEL with BLAST and HHBlits have proven useful for analyzing how missense mutations might affect FOXRED1 structure and function .

How is FOXRED1 targeted to mitochondria?

To investigate mitochondrial targeting experimentally, researchers should employ subcellular fractionation techniques followed by western blotting to detect FOXRED1 in mitochondrial fractions. Comparing the molecular weight of mitochondrial FOXRED1 with the cytosolic precursor can help determine if cleavage occurs. Additionally, mutagenesis of the putative N-terminal targeting sequence followed by localization studies using fluorescent tags can clarify the importance of this sequence for proper targeting.

What diseases are associated with FOXRED1 mutations?

Mutations in the FOXRED1 gene have been primarily associated with Leigh syndrome and infantile-onset mitochondrial encephalopathy . The clinical manifestations can vary significantly, with recent research expanding the known clinical spectrum. For example, case studies have identified ataxia, epilepsy, and psychomotor developmental delay in patients carrying specific FOXRED1 variants including c.920G>A (p.Gly307Glu) and c.733+1G>A .

Researchers investigating FOXRED1-related disorders should be aware that the variability in clinical presentation necessitates careful phenotype-genotype correlation studies and functional validation of newly identified variants.

How can researchers assess pathogenicity of FOXRED1 variants?

A multi-faceted approach is recommended for determining pathogenicity of FOXRED1 variants:

  • In silico analysis: Utilize evolutionary conservation metrics (GERP, PhyloP, phastCons), pathogenicity prediction tools (MutationTaster, FATHMM, DANN, SIFT, Provean), and minor allele frequency (MAF) data to initially assess variant significance .

  • Biochemical analysis: Measure complex I activity in patient samples (fibroblasts, muscle biopsies) to confirm mitochondrial dysfunction .

  • Protein analysis: Perform SDS-PAGE and blue native PAGE immunoblot analysis to assess FOXRED1 protein levels and complex I assembly, respectively .

  • Functional complementation: Implement rescue experiments by expressing wild-type FOXRED1 in patient-derived cells to determine if defects can be reversed.

Recent research has demonstrated how these approaches can be integrated, showing that variants such as p.Gly307Glu affect the steady-state level of complex I holoenzyme in patient fibroblasts, confirming pathogenicity and revealing the molecular mechanism behind disease manifestation .

What techniques are recommended for assessing FOXRED1 enzymatic activity?

Several complementary approaches can be used to assess FOXRED1 enzymatic activity, drawing from methodologies used to study related FAD-dependent enzymes:

  • DCPIP (2,6-dichlorophenolindophenol) reduction assay: This spectrophotometric method measures the reduction of DCPIP, which acts as an electron acceptor in FAD-dependent oxidation reactions. The assay provides a qualitative assessment of enzyme activity after relatively long incubation periods .

  • Peroxidase-coupled assays: These assays utilize peroxidase and o-dianisidine to detect hydrogen peroxide production during FAD enzyme activity with oxygen as an electron acceptor. This approach helps determine if the enzyme efficiently uses molecular oxygen as an electron acceptor .

  • Coupled enzymatic assays: For specific product detection, researchers can employ secondary enzymes that react with the products of FOXRED1 activity. For example, alcohol dehydrogenase (ADH) coupled with NADH can detect aldehyde formation, while glutamate dehydrogenase (GDH) can detect ammonia release .

  • Kinetic analysis: Michaelis-Menten kinetics should be determined by measuring reaction rates at varying substrate concentrations. Parameters such as Km, kcat, and catalytic efficiency (kcat/Km) provide important insights into substrate specificity and reaction efficiency .

When analyzing FOXRED1 activity, researchers should note that the catalytic efficiency (kcat/Km) of related FAD-dependent enzymes typically ranges from 2×10³ to 5×10⁴ M⁻¹s⁻¹, with Km values between 0.2-5 mM .

How can researchers analyze FOXRED1's role in complex I assembly?

To investigate FOXRED1's role in complex I assembly, researchers should implement the following techniques:

  • Blue Native PAGE (BN-PAGE): This technique separates native protein complexes according to size while preserving their interactions. Use BN-PAGE followed by immunoblotting with antibodies against complex I subunits to visualize assembly intermediates and the fully assembled complex I .

  • Immunoprecipitation: Perform co-immunoprecipitation experiments with tagged FOXRED1 to identify interaction partners during complex I assembly.

  • Pulse-chase experiments: These can reveal the temporal sequence of complex I assembly and the stage at which FOXRED1 is involved.

  • RNA interference or CRISPR-Cas9 gene editing: Knockdown or knockout of FOXRED1 followed by analysis of complex I assembly intermediates can identify the specific steps requiring FOXRED1.

  • Complementation studies: Express wild-type or mutant FOXRED1 in FOXRED1-deficient cells to assess rescue of complex I assembly defects.

In particular, mitochondrial fractions from patient and control cell lines should be used for these analyses, with the native mitochondrial complexes solubilized with appropriate detergents (e.g., 2% dodecyl maltoside) before BN-PAGE separation .

How does the FAD-binding mechanism in FOXRED1 compare to other oxidoreductases?

FOXRED1 belongs to a family of FAD-dependent oxidoreductases, and understanding its FAD-binding mechanism requires comparative analysis with related enzymes. Based on structural similarities to sarcosine oxidase (MSOX), FOXRED1's tyrosine residues Y410 and Y411 likely form the covalent attachment site for FAD . This mechanism can be investigated through:

  • Site-directed mutagenesis: Alter key residues (Y410, Y411) and assess FAD binding and enzymatic activity.

  • Spectroscopic analysis: Compare absorption spectra of wild-type and mutant proteins to detect changes in FAD binding.

  • Crystallography or cryo-EM: Determine the three-dimensional structure of FOXRED1 with bound FAD to visualize the binding pocket.

  • Comparative analysis: Examine the catalytic parameters of FOXRED1 against other FAD-dependent enzymes. For context, glycine oxidase from B. licheniformis oxidizes glycine with a kcat/Km of 340 M⁻¹s⁻¹ and Km of 0.9 mM, while monomeric sarcosine oxidase from Bacillus sp. B-0618 oxidizes sarcosine with a kcat/Km of 10,100 M⁻¹s⁻¹ and Km of 4.5 mM .

Understanding FOXRED1's FAD-binding mechanism is crucial for interpreting how mutations might affect its function in disease states.

What methods can resolve contradictory findings about FOXRED1's mitochondrial targeting mechanism?

The literature contains contradictory information regarding FOXRED1's mitochondrial import mechanism, with some evidence suggesting import dependent on membrane potential while other findings point to a cleavable N-terminal localization sequence . Researchers can address this discrepancy through:

  • Import assays with uncouplers: Perform in vitro mitochondrial import assays in the presence of compounds that dissipate the membrane potential (e.g., CCCP) to determine the dependence on membrane potential.

  • N-terminal deletion constructs: Create FOXRED1 constructs lacking the putative 23-amino acid targeting sequence to assess localization.

  • Mass spectrometry: Compare the mass of mature mitochondrial FOXRED1 with the predicted mass of the full-length protein to determine if processing occurs.

  • Pulse-chase experiments: Track the fate of newly synthesized FOXRED1 to detect potential processing during import.

  • In vitro processing assays: Incubate recombinant FOXRED1 with isolated mitochondrial processing peptidase (MPP) to test for cleavage.

A combination of these approaches will help resolve the contradictory findings and establish the actual mechanism of FOXRED1 mitochondrial targeting.

How can researchers reconcile variable clinical presentations with similar FOXRED1 mutations?

The clinical variability observed in patients with FOXRED1 mutations presents a challenge for researchers. To address this variability, the following approaches are recommended:

  • Comprehensive genetic analysis: Look for modifier genes or second-site mutations that might influence disease expression.

  • Tissue-specific expression studies: Examine FOXRED1 expression patterns across tissues in different patients to identify potential differences.

  • Functional analysis of patient-derived cells: Compare complex I activity, assembly, and FOXRED1 function between patients with similar mutations but different clinical presentations.

  • Epigenetic profiling: Investigate whether epigenetic differences might explain variable expressivity of the same mutation.

  • Environmental factor assessment: Consider environmental factors (diet, medications, exposure to toxins) that might interact with FOXRED1 deficiency.

  • Mitochondrial DNA background analysis: Examine whether differences in mitochondrial DNA haplogroups influence the phenotypic expression of FOXRED1 mutations.

This multi-faceted approach may reveal factors that modify the clinical expression of FOXRED1 mutations and explain the expanded clinical spectrum observed in recent research .

What experimental approaches can distinguish between primary and secondary effects of FOXRED1 deficiency?

When studying FOXRED1 deficiency, it's crucial to differentiate between direct consequences of FOXRED1 dysfunction and downstream secondary effects. Researchers can employ these strategies:

These approaches can help researchers develop more precise models of FOXRED1 function and its role in disease pathogenesis.

How might novel structural biology techniques advance understanding of FOXRED1 function?

Emerging structural biology techniques offer new opportunities to elucidate FOXRED1 function:

  • Cryo-electron microscopy (cryo-EM): This technique can reveal the structure of FOXRED1 alone and in complex with assembly intermediates of complex I, providing insights into its chaperone function.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can identify dynamic regions in FOXRED1 that undergo conformational changes during interaction with complex I components.

  • Cross-linking mass spectrometry (XL-MS): By identifying residues in close proximity during protein-protein interactions, this technique can map the interaction surfaces between FOXRED1 and its partners.

  • AlphaFold and other AI-based structure prediction tools: These computational approaches can generate increasingly accurate structural models for FOXRED1 and its variants, enabling prediction of functional consequences of mutations.

  • Time-resolved structural studies: These can capture FOXRED1 in different conformational states during its catalytic cycle or chaperone function.

Researchers should consider that protein modeling techniques have already been useful in studying FOXRED1 variants, with SWISS-MODEL template libraries searched using BLAST and HHBlits for evolutionary-related structures matching the target sequence .

What are emerging therapeutic approaches targeting FOXRED1-related disorders?

Research into treatments for FOXRED1-related disorders is still developing, but several promising approaches warrant investigation:

  • Gene therapy: Development of viral vectors for delivery of functional FOXRED1 to affected tissues, particularly the central nervous system for neurological manifestations.

  • Enzyme replacement therapy: Engineering of FOXRED1 protein with mitochondrial targeting sequences and cell-penetrating peptides for delivery to mitochondria.

  • Small molecule chaperones: Screening for compounds that can stabilize mutant FOXRED1 proteins and enhance their residual function.

  • Metabolic bypass strategies: Identification of alternative metabolic pathways that can circumvent complex I deficiency caused by FOXRED1 mutations.

  • Mitochondrial replacement therapy: For severe cases, investigating the potential of mitochondrial replacement techniques to prevent transmission of mitochondrial dysfunction.

  • CRISPR-based approaches: Development of base editing or prime editing techniques for correction of common FOXRED1 mutations in affected tissues.

These therapeutic strategies should be evaluated in cellular and animal models of FOXRED1 deficiency before clinical translation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.