Recombinant Human Failed axon connections homolog (FAXC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FAXC; C6orf168; Failed axon connections homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-409
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAXC
Target Protein Sequence
MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSD PWWKKTLYLTGGALLAAAAYLLHELLVIRKQQEIDSKDAIILHQFARPNNGVPSLSPFCL KMETYLRMADLPYQNYFGGKLSAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLG PHERAISRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKG IVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAM WTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSEGSKTHTPLLD FSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVDMDDYTDHEQCK
Uniprot No.

Target Background

Function
Plays a potential role in axonal development.
Database Links

HGNC: 20742

KEGG: hsa:84553

STRING: 9606.ENSP00000374328

UniGene: Hs.573245

Protein Families
FAX family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural characterization of human FAXC protein?

Human FAXC protein is a metaxin-like protein containing characteristic GST_N_Metaxin and GST_C_Metaxin protein domains, which are critical structural features shared with the metaxin protein family . Additionally, FAXC contains the Tom37 domain, particularly common in vertebrate variants . The protein exhibits a distinctive secondary structure dominated by α-helices, specifically containing eight α-helical segments (H1-H8) that closely resemble the pattern found in human metaxin 1 . Despite this structural similarity, FAXC shares relatively low sequence identity with metaxins (approximately 17-19% with human metaxin 1), suggesting they represent distinct protein categories with convergent structural features .

How does human FAXC compare phylogenetically to FAXC proteins in other species?

Human FAXC represents part of a highly conserved protein family found across vertebrates and numerous invertebrate phyla. FAXC proteins are particularly abundant in Mollusca, Arthropoda (including Insecta and Arachnida), Cnidaria, and Placozoa . While vertebrates typically possess a single FAXC gene, many invertebrates contain multiple FAXC genes. For example, Exaiptasia diaphana (sea anemone) has at least 12 FAXC genes, and Branchiostoma floridae (Florida lancelet) contains at least 10 . Sequence alignment between different invertebrate FAXC proteins reveals high conservation, with some FAXC variants in the same species sharing up to 54-69% sequence identity .

What is known about FAXC gene organization and expression in humans?

The human FAXC gene is located at cytogenetic position 6q16.2 and is also known as C6Orf168 (Chromosome 6 Open Reading Frame 168) . The gene encodes multiple isoforms, with human FAXC isoform 1 being extensively studied. While expression patterns have not been comprehensively characterized in the literature, the structural similarity to Drosophila Fax protein suggests potential enrichment in neural tissues, particularly in axons . Based on its homology to Drosophila Fax, which functions in axonal development, human FAXC may play similar roles in the nervous system, though direct experimental evidence confirming this function in humans is currently limited .

What experimental approaches are most effective for producing recombinant human FAXC protein?

Based on the structural characteristics of FAXC as a metaxin-like protein with multiple α-helical domains, the following expression system would be optimal:

Recommended Expression System for Recombinant FAXC:

ParameterRecommended ApproachRationale
Expression HostMammalian cell lines (HEK293, CHO)Ensures proper folding and potential post-translational modifications
VectorpCDNA3.1 with C-terminal His-tagAllows efficient purification while minimizing tag interference with N-terminal domains
InductionConstitutive CMV promoterProvides reliable expression levels for complex proteins
Solubility EnhancersAddition of 0.1% NP-40 during lysisMaintains solubility of α-helical proteins
PurificationNi-NTA followed by size exclusionTwo-step purification to ensure homogeneity

For researchers struggling with protein solubility, consider fusion protein approaches with thioredoxin or MBP tags, as these have proven effective for other proteins with similar α-helical content .

How can researchers distinguish between FAXC and metaxin proteins in experimental systems?

Despite structural similarities, distinguishing between FAXC and metaxin proteins is essential for accurate research. The following methodological approaches can help differentiate these proteins:

What experimental models are most suitable for studying FAXC function?

Based on evolutionary conservation patterns and the originally identified role of Fax in Drosophila, the following experimental models offer significant advantages for FAXC research:

Model SystemAdvantagesKey Applications
Drosophila melanogaster- Original system where fax was identified
- Genetic toolkit available
- Established connection to Abl signaling
Axon guidance studies, genetic interaction screens
Zebrafish (Danio rerio)- Possesses two FAXC genes (faxca, faxcb)
- Transparent embryos for live imaging
- Accessible CNS development
In vivo visualization of axon guidance, CRISPR-based studies
Primary neuron cultures- Allows study of human FAXC in relevant cell type
- Controllable environment
Axon growth/guidance assays, protein localization studies
iPSC-derived neural models- Human-specific contexts
- Disease modeling capabilities
Complex neural development studies, disease-relevant research

When designing knockout or knockdown experiments, researchers should consider potential compensation between FAXC paralogs, particularly in zebrafish which contains two FAXC genes (faxca and faxcb) .

How can protein domain analysis guide functional studies of recombinant FAXC?

The domain architecture of FAXC provides critical insights for designing functional studies:

  • GST_N_Metaxin and GST_C_Metaxin Domains: These domains suggest potential glutathione-related functions, possibly involving detoxification or redox regulation. Experimental approaches should include GST activity assays with recombinant FAXC to test this hypothesis .

  • Tom37 Domain: Present in FAXC, particularly in vertebrates, this domain in metaxins functions in protein import into mitochondria. Researchers should investigate potential mitochondrial associations through fractionation studies and protein import assays .

  • α-Helical Structure: The eight α-helical segments (H1-H8) that characterize FAXC suggest potential protein-protein interaction surfaces. Methodologies such as yeast two-hybrid screening or co-immunoprecipitation followed by mass spectrometry could identify interaction partners .

  • Domain Truncation Studies: Creating recombinant FAXC variants with specific domain deletions can help map essential regions for function and localization. Each construct should be tested for proper folding using circular dichroism before functional assessment .

What challenges exist in interpreting FAXC knockout phenotypes?

When analyzing FAXC knockout models, researchers should consider several important factors:

  • Redundancy Considerations: Low sequence identity between FAXC and metaxins (17-19%) suggests distinct functions, but shared structural features may indicate some functional overlap. Design experiments to assess potential compensation by metaxins in FAXC knockout systems .

  • Species-Specific Effects: In Drosophila, Fax protein is not essential for viability in otherwise wild-type flies, except when flies are also mutant in the Abl gene. This synthetic lethality suggests FAXC may function in redundant pathways requiring dual inhibition to observe phenotypes .

  • Paralog Compensation: Species with multiple FAXC genes (like many invertebrates) may show compensation between paralogs. For example, in zebrafish with both faxca and faxcb genes, double knockouts may be necessary to reveal phenotypes .

  • Tissue-Specific Effects: Given the potential neural function suggested by Drosophila studies, careful examination of axon guidance and neuronal connectivity should be prioritized even if gross developmental phenotypes are absent .

What bioinformatic approaches are recommended for analyzing FAXC sequence conservation?

For comprehensive evolutionary analysis of FAXC proteins, researchers should employ the following methodological workflow:

How should researchers design site-directed mutagenesis experiments for FAXC?

When planning site-directed mutagenesis of recombinant FAXC, prioritize the following targets based on structural analysis:

  • Conserved Residues Between Species: Target amino acids that show high conservation across vertebrate and invertebrate FAXC proteins, particularly focusing on residues within the GST_N_Metaxin and GST_C_Metaxin domains .

  • α-Helical Interface Residues: Identify and mutate residues on the surfaces of the eight α-helical segments (H1-H8) that are likely involved in protein-protein interactions .

  • Domain Boundary Residues: Create mutations at the boundaries between identified domains to assess domain independence and potential allosteric regulation .

  • Non-conserved Residues Between FAXC and Metaxins: To investigate FAXC-specific functions, target residues that differ between FAXC and metaxins but are conserved among FAXC proteins across species .

For each mutant, perform circular dichroism analysis to confirm proper folding before proceeding to functional assays.

What purification strategies optimize yield and activity of recombinant FAXC?

Based on the metaxin-like characteristics of FAXC, the following purification strategy is recommended:

Purification StageTechniqueBuffer CompositionCritical Parameters
Initial CaptureImmobilized Metal Affinity Chromatography (IMAC)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazoleMaintain reducing conditions with 1 mM DTT
Intermediate PurificationIon Exchange Chromatography20 mM Tris-HCl pH 7.5, 50-500 mM NaCl gradientDetermine optimal pH based on FAXC isoelectric point
PolishingSize Exclusion Chromatography20 mM HEPES pH 7.4, 150 mM NaCl, 5% glycerolMonitor for oligomeric states
Storage Conditions-20 mM HEPES pH 7.4, 150 mM NaCl, 10% glycerolAliquot and flash-freeze; avoid repeated freeze-thaw cycles

For researchers experiencing aggregation issues, adding low concentrations (0.05-0.1%) of non-ionic detergents like NP-40 or testing various pH conditions (6.5-8.5) may improve stability of the recombinant protein .

What are the most promising avenues for elucidating FAXC function in human cells?

Based on current knowledge of FAXC structure and evolutionary conservation, future research should prioritize:

  • Interactome Mapping: Employ BioID or proximity labeling approaches to identify proteins that interact with FAXC in neural contexts. Compare results with known metaxin interactors to identify unique and shared interaction partners .

  • CRISPR Screening: Conduct CRISPR-based screens in neural cell models to identify genetic interactions with FAXC, particularly focusing on genes involved in axon guidance and development based on the Drosophila connection to axonal development .

  • Subcellular Localization Studies: Determine precise subcellular localization of FAXC using super-resolution microscopy techniques, with particular attention to potential mitochondrial association (suggested by Tom37 domain) and axonal localization .

  • Functional Assays in Human iPSC-derived Neurons: Develop quantitative assays measuring axon growth, guidance, and connectivity in human neural models with FAXC manipulation .

  • Comparative Analysis with Abl Signaling: Given the connection between Fax and Abl in Drosophila, investigate potential interactions between human FAXC and ABL kinases in human cell systems .

How might structural biology approaches advance understanding of FAXC function?

While no crystal structure of FAXC currently exists in the literature, structural biology approaches offer significant potential for advancing understanding:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.