Recombinant Human Fat storage-inducing transmembrane protein 1 (FITM1)

Shipped with Ice Packs
In Stock

Description

Lipid Droplet Formation

FITM1 directly binds TAG and diacylglycerol (DAG) via its transmembrane domains, mediating LD accumulation in a cell-autonomous manner . Unlike diacylglycerol O-acyltransferase (DGAT) enzymes, FITM1 prioritizes TAG sequestration over synthesis .

Key Findings

  • Binding Specificity: FITM1 exhibits weaker TAG/DAG-binding affinity than FITM2, correlating with its role in forming smaller, metabolically active LDs in muscle .

  • Gain-of-Function Mutants: FITM2-FLL(157–9)AAA, a mutant with enhanced TAG-binding capacity, produces larger LDs than wild-type FITM2, underscoring the role of binding affinity in LD size regulation .

  • Loss-of-Function Mutants: FITM2-N80A, a partial loss-of-function mutant, reduces TAG/DAG binding by ~55% and diminishes LD size by ~30%, confirming the mechanistic link between binding and LD dynamics .

Recombinant FITM1 in Experimental Systems

The wheat germ-expressed recombinant FITM1 protein (ab165727) is validated for use in:

ApplicationDetails
ELISADetects FITM1-specific antibodies in immunoassays .
Western Blot (WB)Identifies FITM1 expression in tissue lysates or cell cultures .
Biochemical StudiesExamines TAG/DAG-binding kinetics and LD formation in vitro .

Cancer Prognosis

FITM1 hypermethylation is associated with non-viral hepatocellular carcinoma (HCC) progression :

  • Epigenetic Silencing: High methylation of CpG sites (e.g., cg20306574) correlates with reduced FITM1 expression and poorer survival in HCC patients .

  • Tumor Suppression: FITM1 downregulation activates cancer-related pathways (e.g., NOTCH signaling), while its restoration may suppress tumor growth .

Toxicological and Metabolic Insights

FITM1 expression is modulated by environmental and pharmacological agents:

AgentEffect on FITM1 ExpressionMechanism
Bisphenol A↓ (decreased) Estrogen receptor-mediated repression
Peroxisome Proliferators↑ (increased) PPARα activation
Doxorubicin↓ (decreased) Anticancer drug-induced toxicity

These interactions highlight FITM1’s role in metabolic stress responses and lipid homeostasis .

Comparative Analysis with FITM2

FITM1 and FITM2 exhibit distinct tissue-specific roles and biochemical properties:

ParameterFITM1FITM2
Primary TissueSkeletal muscle Adipose tissue
LD MorphologySmall, dynamic LDs Large, storage-oriented LDs
PPARγ RegulationLimited Directly regulated by PPARγ

Future Directions

Recombinant FITM1 remains critical for:

  1. Therapeutic Targeting: Exploring FITM1 reactivation in non-viral HCC .

  2. Metabolic Diseases: Investigating its role in obesity and insulin resistance.

  3. Structural Biology: Solving FITM1’s 3D structure to map TAG/DAG-binding sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FITM1; FIT1; Fat storage-inducing transmembrane protein 1; Fat-inducing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FITM1
Target Protein Sequence
MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL AAVVIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAV TARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRG YTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTV IYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKHN
Uniprot No.

Target Background

Function

FITM1 plays a crucial role in lipid droplet (LD) biogenesis. LDs are essential organelles for lipid and energy homeostasis. FITM1 directly interacts with diacylglycerol (DAGs) and triacylglycerol.

Database Links

HGNC: 33714

OMIM: 612028

KEGG: hsa:161247

UniGene: Hs.128060

Protein Families
FIT family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Primarily expressed in heart and skeletal muscle.

Q&A

What is the cellular localization of FITM1?

FITM1 is exclusively localized to the endoplasmic reticulum (ER). It is a 292-amino acid protein containing six transmembrane domains with both N and C termini facing the cytosol . This specific localization is critical for its function in mediating triglyceride-rich lipid droplet formation, as it positions FITM1 at the site where lipids are synthesized before being partitioned into storage droplets. In cellular studies, proper localization can be confirmed using ER markers such as calnexin for co-localization experiments . The exclusive ER localization distinguishes FIT proteins from other lipid droplet-associated proteins that may relocate to the droplet surface.

How does FITM1 differ from FITM2 in function and expression patterns?

FITM1 and FITM2 exhibit significant differences in tissue distribution and functional properties. FITM1 is primarily expressed in skeletal muscle with lower levels in heart, whereas FITM2 is ubiquitously expressed at low levels across tissues but shows extremely high expression in adipose tissue . From an evolutionary perspective, FITM2 is the ancient ortholog found as early as in Saccharomyces cerevisiae, while FITM1 orthologs appear only in bony fish and later vertebrates .

Functionally, FITM1 binds weakly to triglycerides compared to FITM2 but may have stronger affinity for diacylglycerols . This biochemical difference suggests specialized roles: FITM2 appears involved in long-term TAG storage in adipose, while FITM1 forms smaller lipid droplets characteristic of rapidly turning over lipid pools in skeletal muscle, potentially linking myocellular TAG reservoirs to mitochondrial respiration for energy production .

What is the mechanism by which FITM1 mediates lipid droplet formation?

FITM1 mediates lipid droplet formation through direct binding to triglycerides and diacylglycerols, facilitating their partitioning into lipid droplets . Unlike diacylglycerol O-acyltransferases (DGAT1 and DGAT2), which synthesize triglycerides, FITM1 does not possess enzymatic activity for triglyceride biosynthesis but rather acts as part of a molecular complex that anchors triglycerides within lipid droplets .

The binding occurs with specificity and saturation-binding kinetics, similar to its paralog FITM2 . Studies with FITM2 have shown that mutations affecting lipid binding correspondingly alter lipid droplet size—a gain-of-function mutant (FLL157-9AAA) showed increased triolein binding and formed larger lipid droplets, while a partial loss-of-function mutant (N80A) exhibited decreased binding and produced smaller droplets . This mechanism represents a unique biochemical function in lipid metabolism where direct physical interaction with lipids facilitates their storage without catalytic conversion.

What is the relationship between FITM1 and metabolic pathways in skeletal muscle?

FITM1's predominant expression in skeletal muscle suggests a specialized role in muscle metabolism . Unlike FITM2, which is associated with long-term triglyceride storage in adipose tissue, FITM1 appears involved in forming smaller lipid droplets that are characteristic of the rapidly turning over lipid pools found in skeletal muscle . This suggests that FITM1-directed lipid droplet formation may play a crucial role in linking myocellular triglyceride energy reservoirs to mitochondrial respiration.

The dynamics of lipid droplet turnover for fatty acid release would be expected to play an important role in maintaining energy homeostasis in skeletal muscle, which relies heavily on fatty acid oxidation for ATP production . FITM1 connects with proteins involved in energy metabolism including adiponectin and leptin, which play significant roles in energy homeostasis . The lower binding affinity of FITM1 for triglycerides compared to FITM2 may reflect an adaptation facilitating more rapid mobilization of fatty acids from lipid droplets in response to changing energy demands in muscle tissue.

How has FITM1 been implicated in disease processes?

Research has identified FITM1 as a potential tumor suppressor gene in non-viral hepatocellular carcinoma (HCC) . FITM1 methylation is significantly upregulated in tumor specimens compared to normal tissues, and this hypermethylation correlates with reduced gene expression . Specifically, the methylation of the cg20306574 site shows a strong negative correlation with FITM1 expression levels, and high methylation at this site predicts poorer prognosis in non-viral HCC patients .

Gene Set Enrichment Analysis (GSEA) has revealed that low FITM1 expression activates cancer-related pathways, while several metabolism-related signaling pathways might account for the anti-tumor effects of FITM1 . Immunohistochemistry confirms that FITM1 expression is much higher in normal liver tissues than in HCC tissues . FITM1 methylation has been incorporated into a prognostic risk signature for non-viral HCC (risk score = 4.37 * methylation of ABCG5 - 9.31 * methylation of FES + 9.61 * methylation of FITM1), emphasizing its potential clinical relevance .

What are the validated methods for purifying recombinant FITM1?

Several validated approaches exist for purifying recombinant FITM1. For research applications requiring full-length protein, expression in wheat germ systems has been successful, yielding protein suitable for ELISA and Western blot applications . For bacterial expression systems, recombinant FITM1 can be purified using affinity tags such as StrepII-tag, followed by appropriate detergent solubilization.

Due to FITM1's transmembrane nature, detergent selection is critical—Fos-choline 13 has been reported effective for extraction while maintaining protein function . After initial purification, gel filtration chromatography can further enhance purity, with Superdex 200 HR 10/30 column chromatography at a flow rate of 0.5 mL/min having been successfully used for FIT proteins . Protein quality can be verified through SDS-PAGE with Coomassie Blue staining and circular dichroism (CD) spectroscopy to confirm proper protein folding .

How can the lipid-binding properties of FITM1 be accurately measured?

The lipid-binding properties of FITM1 can be accurately assessed through several complementary approaches. Radiolabeled-lipid binding assays with purified StrepII-tagged FITM1 involve mixing the protein with Ni-nitrilotriacetate beads or Strep-tactin slurry and 3H-labeled lipids . After incubation and extensive washing, retained radioactivity is measured to quantify binding.

Competition binding assays can determine specificity by including excess unlabeled lipid competitors . For cell-based approaches, HEK293 cells transfected with tagged FITM1 constructs can be extracted in appropriate detergents at 4°C, followed by immunoprecipitation and standard binding assays . Additionally, coelution assays where recombinant FITM1 protein and radioactive triolein are coincubated, followed by elution with desthiobiotin, can determine if the protein and lipid elute together .

These methods should be performed with appropriate controls, including competition with different lipid species to establish binding specificity and comparison with known lipid-binding proteins to validate assay performance.

What imaging techniques can be used to visualize FITM1-mediated lipid droplet formation?

Several imaging techniques can effectively visualize FITM1-mediated lipid droplet formation. Confocal microscopy represents the gold standard, allowing high-resolution imaging of both FITM1 localization (using immunofluorescence with antibodies against FITM1 or epitope tags) and lipid droplets (using lipophilic dyes such as BODIPY or Nile Red) .

For quantitative analysis of lipid droplet size and number, software such as Volocity can process confocal images . When designing imaging experiments, it's crucial to include appropriate controls such as calnexin staining to confirm ER localization of FITM1 . HEK293 cells have been successfully used as a model system for transfection with FITM1 constructs to study lipid droplet formation .

The relationship between FITM1 expression and lipid droplet parameters can provide insights into its function. Studies with related proteins have shown that mutations affecting lipid binding correspondingly alter lipid droplet morphology, with stronger binding correlating with larger droplets and weaker binding with smaller droplets .

What cell culture models are most appropriate for studying FITM1 function?

Given FITM1's predominant expression in skeletal muscle, myocyte cell lines such as C2C12 (mouse myoblasts) or primary human skeletal muscle cells represent physiologically relevant models for studying its native function. For overexpression studies, HEK293 cells have been successfully used to assess FITM1's role in lipid droplet formation , offering a clean background with minimal endogenous expression.

When investigating FITM1's potential tumor suppressor role in liver cancer, hepatocyte cell lines would be appropriate. For all cell models, verification of proper FITM1 localization to the endoplasmic reticulum is essential, using markers such as calnexin for colocalization studies .

To study the functional consequences of FITM1 activity, cells should be cultured under conditions that promote lipid droplet formation, such as supplementation with oleic acid, or in the case of muscle cells, under conditions that mimic exercise or fasting states. Quantification of lipid droplet parameters (size, number, distribution) following FITM1 manipulation can provide insights into its specific functions.

How can researchers troubleshoot issues with recombinant FITM1 expression?

Troubleshooting recombinant FITM1 expression requires addressing several potential challenges. As a multi-transmembrane protein, FITM1 may exhibit folding issues or aggregation during expression. For bacterial systems, lowering induction temperature (16-20°C), reducing inducer concentration, and using specialized E. coli strains designed for membrane proteins can improve yields of properly folded protein.

For eukaryotic expression, wheat germ cell-free systems have been successfully used to produce full-length FITM1 . The choice of affinity tag and its position (N- versus C-terminal) can significantly impact expression and functionality—both termini of FITM1 face the cytosol, making them potentially accessible for tagging .

Detergent selection for extraction is critical; Fos-choline 13 has been reported effective , but screening multiple detergents may be necessary. For purified protein, assessing proper folding through circular dichroism spectroscopy before functional assays can help identify structural issues . When expressing FITM1 in mammalian cells for localization studies, verification of proper ER localization using markers such as calnexin is essential to confirm physiologically relevant expression .

How does FITM1 methylation status influence its role as a tumor suppressor?

FITM1 methylation status plays a critical role in its function as a tumor suppressor, particularly in non-viral hepatocellular carcinoma (HCC). Research has demonstrated that FITM1 methylation is significantly upregulated in tumor specimens compared to normal tissues (Log FC = 0.49, P-value = 2.00E-09) . A specific CpG methylated site, cg20306574, shows a strong negative correlation with FITM1 expression levels .

High methylation at this site predicts poorer prognosis in non-viral HCC patients, suggesting that epigenetic silencing of FITM1 contributes to cancer progression . Gene Set Enrichment Analysis (GSEA) has revealed that low FITM1 expression activates cancer-related pathways, while several metabolism-related signaling pathways might account for the anti-tumor effects of FITM1 .

Notably, FITM1 methylation has been incorporated into a prognostic risk signature for non-viral HCC (risk score = 4.37 * methylation of ABCG5 - 9.31 * methylation of FES + 9.61 * methylation of FITM1), emphasizing its pivotal role in cancer biology . This suggests that assessment of FITM1 methylation status could have clinical utility in prognosticating HCC patients and potentially guiding treatment decisions.

What structural features of FITM1 contribute to its lipid binding specificity?

FITM1 is a 292-amino acid protein with six transmembrane domains, with both N and C termini facing the cytosol . While FITM1 does not share homology with known protein domains or other protein families, it belongs to the evolutionarily conserved FIT family, specifically the FIT1 subfamily .

The transmembrane domains are likely critical for its lipid binding capabilities. Although specific binding sites have not been fully mapped for FITM1, studies on the related protein FIT2 provide valuable insights. Mutations in FIT2 can create gain-of-function (forming larger lipid droplets with increased binding) or partial loss-of-function (producing smaller lipid droplets with decreased binding) phenotypes , suggesting that similar functional regions may exist in FITM1.

FITM1 exhibits lower binding affinity for triglycerides compared to FITM2 but may have higher affinity for diacylglycerols . This differential binding profile suggests structural adaptations that favor interaction with specific lipid species. Understanding these structural determinants could provide insights into FITM1's specialized function in muscle tissue and potentially guide the development of modulators for therapeutic applications.

How does the evolutionary relationship between FITM1 and FITM2 inform our understanding of their functions?

The evolutionary history of FIT proteins provides valuable insights into their specialized functions. FITM2 is the ancient ortholog of the FIT family, with orthologs found as early as in Saccharomyces cerevisiae, whereas orthologs of FITM1 appear only as early as bony fish . This evolutionary timeline suggests that FITM2 represents the ancestral function of triglyceride storage, while FITM1 evolved later with specialized functions in vertebrates.

Despite sharing 50% similarity at the amino acid level, their distinct binding preferences for triglycerides versus diacylglycerols and their different tissue expression patterns suggest divergent evolutionary adaptations . FITM2's high expression in adipose tissue and strong triglyceride binding aligns with the fundamental need for long-term energy storage across all eukaryotes.

In contrast, FITM1's muscle-specific expression and weaker triglyceride binding may represent an adaptation in higher vertebrates for rapid energy mobilization in tissues requiring dynamic metabolism . This evolutionary specialization suggests that therapeutic approaches targeting FITM1 might achieve tissue-specific effects without disrupting the more fundamental and widespread functions of FITM2.

What are the implications of FITM1's role in lipid metabolism for potential therapeutic applications?

FITM1's specialized role in lipid metabolism, particularly in skeletal muscle, suggests several potential therapeutic applications. As FITM1 appears involved in the formation of small, rapidly turning over lipid droplets in muscle tissue , modulating its activity might influence fatty acid availability for mitochondrial oxidation, potentially affecting muscle energy metabolism during exercise or in metabolic disorders.

The identification of FITM1 as a tumor suppressor in hepatocellular carcinoma suggests that strategies to restore its expression or function might have anti-cancer effects. Since DNA methylation appears to be a key mechanism suppressing FITM1 expression in cancer , epigenetic therapies targeting this methylation could potentially restore FITM1 expression and its tumor-suppressive functions.

Additionally, given FITM1's connections with proteins involved in energy metabolism including adiponectin and leptin , it may represent a novel target for metabolic disorders. The tissue-specific expression of FITM1 primarily in skeletal muscle offers the advantage of potentially developing interventions with tissue-selective effects, minimizing off-target impacts in other tissues.

How does the direct binding of triglycerides by FITM1 challenge traditional models of lipid droplet formation?

The discovery that FITM1 directly binds triglycerides challenges traditional models of lipid droplet formation in several ways. Conventionally, lipid droplet formation has been viewed as a physicochemical process where triglycerides accumulate between the leaflets of the ER membrane until reaching a critical mass that drives budding. The identification of proteins that directly bind triglycerides suggests a more regulated, protein-driven process .

Unlike other proteins involved in lipid droplet biology, FIT proteins have the unique ability to partition triglycerides into lipid droplets without catalyzing their synthesis . This distinguishes them from enzymes like DGAT1 and DGAT2, which synthesize triglycerides but don't directly mediate their packaging into droplets.

The finding that different FIT proteins (FITM1 and FITM2) bind triglycerides with different affinities and form lipid droplets of different sizes suggests that the protein composition of the ER can directly influence the morphology and potentially the metabolic availability of stored lipids . This challenges the view of lipid droplets as passive storage organelles and suggests they may be actively tailored to tissue-specific metabolic needs through the action of proteins like FITM1.

How should quantitative data on FITM1-mediated lipid droplet formation be analyzed?

Analysis of FITM1-mediated lipid droplet formation requires robust quantitative approaches to capture multiple parameters. Image-based quantification should assess lipid droplet number, size distribution, total volume per cell, and spatial distribution within the cell. Software such as Volocity has been successfully used for processing confocal images of lipid droplets .

Data normalization is critical—metrics should be normalized to cell size, total cell number, or FITM1 expression level to enable meaningful comparisons between conditions. For experiments comparing wild-type FITM1 to mutants or FITM1 to FITM2, paired analytical approaches that account for experimental batch effects are recommended.

Correlation analyses between FITM1 expression levels and lipid droplet parameters can establish dose-response relationships that strengthen mechanistic interpretations. When interpreting results, it's important to consider that FITM1 naturally forms smaller lipid droplets compared to FITM2 , so the absolute size of droplets should be interpreted in the context of the specific protein being studied rather than compared to general lipid droplet formation.

What statistical approaches are most appropriate for analyzing FITM1 methylation patterns in cancer studies?

When analyzing FITM1 methylation patterns in cancer studies, several statistical approaches have proven valuable. For identifying differential methylation between tumor and normal tissues, paired tests should be applied to account for patient-specific variations, as was done in studies showing FITM1 hypermethylation in HCC (Log FC = 0.49, P-value = 2.00E-09) .

The relationship between methylation at specific sites (particularly cg20306574) and FITM1 expression can be assessed using correlation coefficients . For survival analyses, Kaplan-Meier curves with log-rank tests can evaluate the prognostic significance of FITM1 methylation, as shown in studies where high cg20306574 methylation predicted poorer prognosis in non-viral HCC patients .

When building methylation-based risk signatures, LASSO regression is appropriate for feature selection, followed by multivariate Cox regression to determine coefficients, as demonstrated in the development of a prognostic signature incorporating FITM1 methylation . For clustering analyses, ConsensusClusterPlus has been successfully used to identify patient subgroups based on methylation patterns , providing a framework for patient stratification that may have clinical relevance.

How can researchers integrate FITM1 data across multiple experimental approaches?

Integrating FITM1 data across multiple experimental approaches requires careful consideration of how different methodologies complement each other. Correlating biochemical data on FITM1's lipid binding properties with cellular observations of lipid droplet formation provides mechanistic validation—for instance, mutations that affect binding strength correspondingly alter lipid droplet size .

When combining in vitro binding data with cellular studies, it's important to consider the lipid environment; the composition of lipids available in cell culture may affect the observed phenotypes. For translational research, connecting molecular findings about FITM1 methylation with clinical outcomes requires appropriate statistical models that account for patient heterogeneity and potential confounding factors .

Network analysis approaches can place FITM1 within broader functional contexts by integrating expression, methylation, and protein interaction data. When examining FITM1's potential tumor suppressor role, correlating methylation status with expression levels and downstream pathway activation (as done using GSEA ) provides a more comprehensive understanding than any single data type alone.

What are the key considerations when comparing FITM1 and FITM2 in experimental studies?

When comparing FITM1 and FITM2 in experimental studies, several key considerations should guide study design and interpretation. First, their distinct tissue expression patterns must be acknowledged—FITM1 is primarily expressed in skeletal muscle, while FITM2 is highest in adipose tissue but more ubiquitously expressed . This may necessitate different cell models for physiologically relevant studies.

Their differential binding affinities for triglycerides (FITM1 binds more weakly than FITM2) and potentially diacylglycerols should inform the choice of lipids used in binding assays and cellular studies. When examining lipid droplet formation, baseline expectations should reflect their natural tendencies—FITM1 typically forms smaller droplets than FITM2 .

How should researchers interpret conflicting data on FITM1 function?

Interpreting conflicting data on FITM1 function requires systematic analytical approaches. Context dependency should be the first consideration—apparent contradictions may result from different cell types, experimental conditions, or species being studied. Methodological differences can significantly impact results; comparing studies using recombinant proteins versus cellular overexpression requires careful examination of experimental details.

Quantitative aspects matter—conflicting results might reflect different expression levels or ratios of FITM1 to lipid substrates. When evaluating FITM1's role in disease, patient heterogeneity or differences in disease stage might explain discrepancies in clinical findings.

When comparing FITM1's tumor suppressor role in liver versus its metabolic functions in muscle, it's important to recognize that these may represent tissue-specific functions rather than contradictions. The methylation of FITM1 in HCC and its correlation with clinical outcomes may reflect context-specific regulation that doesn't contradict its fundamental role in lipid metabolism.

How might FITM1 research inform our understanding of muscular metabolic disorders?

FITM1's predominant expression in skeletal muscle and its role in forming rapidly turning over lipid droplets position it as a potentially important player in muscular metabolic disorders. Conditions like insulin resistance and type 2 diabetes involve aberrant intramuscular lipid accumulation and metabolism, which could be influenced by FITM1 function.

FITM1 likely plays a role in linking myocellular triglyceride reservoirs to mitochondrial respiration for energy production , suggesting it might be involved in the metabolic flexibility of muscle tissue—the ability to switch between carbohydrate and fat utilization. Alterations in FITM1 expression or function could potentially contribute to impaired fatty acid utilization in conditions characterized by reduced metabolic flexibility.

Future research should investigate FITM1 expression and function in muscle biopsies from patients with various metabolic disorders, as well as examine potential genetic variants that might affect FITM1 function and their association with disease phenotypes. Additionally, studies in animal models with muscle-specific modulation of FITM1 could provide insights into its physiological importance in muscle metabolism under various nutritional and exercise conditions.

What are promising approaches for developing FITM1-based diagnostic or prognostic tools?

The identification of FITM1 methylation as a prognostic marker in hepatocellular carcinoma suggests several promising approaches for developing FITM1-based diagnostic or prognostic tools. The specific CpG site cg20306574 has shown a strong negative correlation with FITM1 expression and association with patient outcomes , making it a candidate for focused methylation assays.

The incorporation of FITM1 methylation into a three-gene signature with significant prognostic value (risk score = 4.37 * methylation of ABCG5 - 9.31 * methylation of FES + 9.61 * methylation of FITM1) demonstrates the potential of multiparameter approaches. Such signatures could be developed into PCR-based assays suitable for clinical implementation.

Immunohistochemistry for FITM1 protein could serve as a simpler alternative to methylation analysis, as studies have shown reduced FITM1 expression in HCC tissues compared to normal liver . For muscular disorders, quantification of FITM1 in muscle biopsies might provide insights into altered lipid metabolism. Additionally, exploring circulating markers that reflect FITM1 activity could enable non-invasive monitoring of its function in relevant disease states.

What novel experimental models could advance our understanding of FITM1 biology?

Several novel experimental models could significantly advance our understanding of FITM1 biology. CRISPR/Cas9-engineered cell lines with defined FITM1 mutations affecting specific functions (lipid binding, protein interactions) would enable precise mechanistic studies. Inducible systems for FITM1 expression could help distinguish between acute and chronic effects of FITM1 modulation.

Three-dimensional muscle organoids derived from stem cells would provide a more physiologically relevant context than traditional 2D cultures for studying FITM1's role in muscle metabolism. For investigating FITM1's potential tumor suppressor role, patient-derived xenografts from hepatocellular carcinomas with varying FITM1 methylation status could help validate its clinical significance.

Tissue-specific knockout or transgenic mouse models (especially muscle-specific) would allow for in vivo assessment of FITM1's physiological functions under various metabolic challenges. Finally, applying new imaging technologies such as correlative light and electron microscopy or live-cell super-resolution microscopy to visualize FITM1-lipid interactions in real-time could provide unprecedented insights into the dynamics of FITM1-mediated lipid droplet formation.

How might evolutionary insights into FITM1 inform therapeutic approaches?

The evolutionary history of FITM1 provides valuable context for therapeutic development. Since FITM1 appeared later in evolution than FITM2 (as early as bony fish versus yeast for FITM2) , it likely represents a specialized adaptation rather than a core metabolic function, suggesting that its modulation might have more selective effects with potentially fewer side effects.

FITM1's muscle-specific expression pattern further supports the possibility of developing tissue-selective interventions. By understanding the structural divergence between FITM1 and FITM2 that led to their differential lipid binding properties , researchers might design compounds that selectively modulate one protein while sparing the other.

The apparent role of FITM1 in managing rapidly turning over lipid droplets in muscle suggests that therapies enhancing its function might improve metabolic flexibility in conditions like insulin resistance. Conversely, in contexts where FITM1 acts as a tumor suppressor , approaches to reverse its epigenetic silencing or restore its expression might have anti-cancer effects with minimal impact on normal cells that don't typically express high levels of FITM1.

What are the most critical unanswered questions in FITM1 research?

Several critical questions remain unanswered in FITM1 research. At the molecular level, the precise structural determinants of FITM1's lipid binding specificity and the mechanism by which it facilitates lipid droplet formation remain unclear. The identification of the complete interactome of FITM1, particularly in muscle cells, would provide insights into its functional network.

The physiological significance of FITM1's higher expression in skeletal muscle relative to other tissues needs further clarification—does it play an essential role in exercise physiology or muscle energy homeostasis that cannot be compensated by FITM2? The regulatory mechanisms controlling FITM1 expression in normal physiology (beyond the epigenetic silencing observed in cancer ) are also poorly understood.

From a clinical perspective, whether alterations in FITM1 function contribute to muscular metabolic disorders requires investigation. Additionally, while FITM1 methylation has been associated with hepatocellular carcinoma prognosis , its potential involvement in other cancer types needs exploration. Finally, the therapeutic potential of modulating FITM1 activity in either metabolic disorders or cancer remains largely unexplored but represents an exciting frontier for translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.