Recombinant Human Fatty acid 2-hydroxylase (FA2H)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Enzymatic Activity

FA2H is a 372-amino acid protein featuring:

  • An N-terminal cytochrome b5 domain essential for electron transfer during hydroxylation .

  • Four transmembrane domains and a conserved iron-binding histidine motif .

  • Stereospecific activity producing (R)-2-hydroxy fatty acids in mammals .

Table 1: Key Enzymatic Properties

PropertyDetailSource
Molecular Weight~43 kDa
Subcellular LocalizationEndoplasmic reticulum membrane
Catalytic CofactorsNADPH and NADPH:cytochrome P-450 reductase
Primary SubstratesVery-long-chain fatty acids (e.g., C16:0, C24:0, C24:1)

Recombinant Production and Applications

Recombinant FA2H is typically expressed in mammalian cell lines (e.g., COS7) or bacterial systems for functional studies . Key applications include:

  • Myelin Research: FA2H-generated 2-hydroxy galactosylceramides constitute ~60% of myelin lipids in the central nervous system (CNS) and peripheral nervous system (PNS) .

  • Cancer Studies: FA2H overexpression in esophageal squamous cell carcinoma (ESCC) promotes metastasis via TNFα-FOXC2-FA2H signaling, while its knockdown reduces tumor migration .

  • Drug Development: FA2H modulates sensitivity to antitumor agents like PM02734 and cisplatin .

Clinical and Pathological Significance

Table 2: FA2H-Associated Diseases

ConditionMechanismPhenotypeSource
FAHN*Loss-of-function mutations → demyelination, iron accumulationSpastic paraplegia, dystonia, optic atrophy
Hereditary Spastic Paraplegia 35Impaired 2-hydroxylation → leukodystrophyProgressive motor and cognitive decline
Cancer MetastasisFA2H upregulation → altered ceramide metabolismEnhanced cell migration/invasion

*Fatty acid hydroxylase-associated neurodegeneration (FAHN)

Recent Research Findings

  • Neurodegeneration: FA2H mutations reduce 2-hydroxyceramide levels, destabilizing myelin and causing leukodystrophy. Iron accumulation in the globus pallidus is a hallmark of FAHN .

  • Cancer Biology: In ESCC, FA2H depletion increases dihydroceramides (e.g., Cer(d18:0/24:0)), which suppress metastasis by inducing tumor cell apoptosis .

  • Therapeutic Targets: FA2H inhibitors are being explored to block cancer cell migration, while enzyme replacement strategies aim to treat FAHN .

Challenges and Future Directions

  • Unresolved Mechanisms: The link between FA2H mutations and brain iron accumulation remains unclear .

  • Alternative Pathways: Redundant enzymes may partially compensate for FA2H loss, complicating therapeutic targeting .

  • Biomarker Potential: Elevated FA2H expression correlates with poor prognosis in ESCC, suggesting diagnostic utility .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand your specific requirements. Please indicate any preferences for the format when placing your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Store the aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
FA2H; FAAH; FAXDC1; Fatty acid 2-hydroxylase; Fatty acid alpha-hydroxylase; Fatty acid hydroxylase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FA2H
Target Protein Sequence
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISA DLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWD KDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLV LYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHM KPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTV FAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFH TLTPEKPHLKTQ
Uniprot No.

Target Background

Function
Fatty acid 2-hydroxylase (FA2H) is an enzyme that catalyzes the hydroxylation of free fatty acids at the C-2 position, producing 2-hydroxy fatty acids. These 2-hydroxy fatty acids are essential building blocks for sphingolipids and glycosphingolipids, prevalent in neural tissue and epidermis. FA2H exhibits stereospecificity, producing (R)-2-hydroxy fatty acids. It plays a critical role in the synthesis of galactosphingolipids, a key component of the myelin sheath. FA2H is also involved in the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies, crucial for skin permeability barrier function. In sebaceous glands, FA2H participates in the synthesis of glycosphingolipids and a fraction of type II wax diesters, specifically regulating hair follicle homeostasis. Furthermore, it is involved in the synthesis of sphingolipids found in plasma membrane rafts, contributing to the regulation of lipid raft mobility and trafficking of raft-associated proteins.
Gene References Into Functions
  1. Novel mutations in FA2H have been identified in Arab patients presenting with a spectrum of neurodegeneration and hereditary spastic paraparesis. PMID: 25496456
  2. Three novel mutations in Chinese patients have been reported, significantly reducing FA2H enzyme activity and leading to hereditary spastic paraplegia. PMID: 24359114
  3. Studies suggest that induced levels of PPARalpha may be involved in the Delta(9)-THC up-regulation of FA2H in MDA-MB-231 cells. PMID: 25291031
  4. A heterozygous deletion within 16q22.3-q23.1, encompassing FA2H, has been observed in two siblings sharing symptoms of autism and severe cognitive impairment, along with axial T2-FLAIR weighted MRI posterior periventricular white matter lesions. PMID: 24299421
  5. A novel triple heterozygous mutation in the FA2H gene (c.968C>A; c.976G>A; c.688G>A) has been identified in a Chinese family with Hereditary Spastic Paraplegia Type 35. PMID: 23566484
  6. Research indicates that FA2H is a novel (9)-THC-regulated gene, and that (9)-THC induces differentiation signal(s) in poorly differentiated MDA-MB-231 cells. PMID: 23535410
  7. A novel mutation in the FA2H gene has been reported in two siblings presenting with adult onset complicated spastic paraparesis and thin corpus callosum. PMID: 22925154
  8. A study did not find any mutations in the FA2H gene in patients with neurodegeneration with brain iron accumulation. PMID: 22704260
  9. A novel homozygous c.270+3A>T mutation was found to alter FA2H function, leading to a severe phenotype with clinical features overlapping those in three FA2H-associated disorders. PMID: 21592092
  10. The 2-hydroxylated sphingomyelin (SM) profiles were characterized in blood and fibroblasts from patients carrying a deleterious FA2H mutation. PMID: 21599921
  11. Mutations in FA2H have been linked to hereditary spastic paraplegia. PMID: 20104589
  12. The human FA2H gene encodes a fatty acid 2-hydroxylase involved in the formation of myelin 2-hydroxy galactosylceramides and -sulfatides. PMID: 15337768
  13. Increases in FA2H expression during late differentiation are crucial for epidermal permeability barrier homeostasis. PMID: 17355976
  14. Mutations in FA2H have been associated with leukodystrophy with spastic paraparesis and dystonia. PMID: 19068277

Show More

Hide All

Database Links

HGNC: 21197

OMIM: 611026

KEGG: hsa:79152

STRING: 9606.ENSP00000219368

UniGene: Hs.461329

Involvement In Disease
Spastic paraplegia 35, autosomal recessive (SPG35)
Protein Families
Sterol desaturase family, SCS7 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in differentiating cultured keratinocytes (at protein level). Detected in epidermis and cultured keratinocytes. Highly expressed in brain and colon. Detected at lower levels in testis, prostate, pancreas and kidney.

Q&A

What is the structure and function of human FA2H?

Human FA2H is a 372-amino acid protein with several key structural components that are essential for its enzymatic activity. The protein contains an N-terminal cytochrome b5 domain, four potential transmembrane domains, and an iron-binding histidine motif that is conserved among membrane-bound desaturases/hydroxylases . This structure is critical for its function as a fatty acid 2-hydroxylase.

Functionally, FA2H catalyzes the 2-hydroxylation of fatty acids during de novo ceramide synthesis, producing 2-hydroxysphingolipids and 2-hydroxyglycosphingolipids. This enzymatic activity is NADPH-dependent and requires NADPH:cytochrome P-450 reductase . The cytochrome b5 domain is particularly important, as FA2H variants lacking this domain show significantly reduced activity, indicating it is a functional component of the enzyme .

Where is FA2H primarily expressed in humans?

FA2H exhibits tissue-specific expression patterns that correlate with its biological functions. Northern blot analyses have demonstrated that FA2H is highly expressed in brain and colon tissues . Additional studies have shown significant expression in the epidermis . This expression pattern aligns with the physiological roles of 2-hydroxysphingolipids, which are:

  • Abundant in brain myelin, where galactosylceramides and sulfatides contain 2-hydroxy fatty acids

  • Important for skin barrier function in the epidermis

  • Present in the gastrointestinal tract, particularly the colon

Understanding these expression patterns is essential for researchers working with recombinant FA2H, as it provides context for physiologically relevant experimental designs.

What are the optimal expression systems for producing recombinant human FA2H?

For successful expression of enzymatically active recombinant human FA2H, researchers should consider the following methodological approaches:

Mammalian expression systems are generally preferred due to the requirement for proper post-translational modifications and membrane insertion. COS7 cells have been successfully used to express human FA2H, resulting in 3-20-fold higher levels of 2-hydroxyceramides (C16, C18, C24, and C24:1) and 2-hydroxy fatty acids compared to control cells . This indicates that the recombinant protein is enzymatically active in this system.

Key methodological considerations include:

  • Vector selection: Choose vectors with strong promoters suitable for mammalian expression (e.g., CMV promoter)

  • Membrane protein considerations: Include appropriate signal sequences to ensure correct localization to the endoplasmic reticulum

  • Enzymatic activity verification: Measure formation of 2-hydroxy fatty acids and 2-hydroxyceramides in transfected cells

  • Co-expression requirements: Consider co-expressing NADPH:cytochrome P-450 reductase to ensure optimal activity

The inclusion of the N-terminal cytochrome b5 domain is critical, as studies have shown that FA2H lacking this domain has little enzymatic activity . Therefore, expression constructs should maintain the complete protein sequence.

How can FA2H enzymatic activity be measured in vitro?

Measuring the enzymatic activity of recombinant FA2H requires specialized biochemical assays that can detect the 2-hydroxylation of fatty acids. Researchers have successfully used the following methodological approaches:

  • Microsomal fraction assays: Prepare microsomal fractions from cells expressing recombinant FA2H and measure tetracosanoic acid 2-hydroxylase activities in an NADPH- and NADPH:cytochrome P-450 reductase-dependent manner . This approach directly measures the enzymatic activity using its natural substrates.

  • Lipid extraction and analysis: Extract and analyze lipids from cells expressing FA2H to quantify 2-hydroxyceramides and 2-hydroxy fatty acids using techniques such as:

    • Thin-layer chromatography (TLC)

    • High-performance liquid chromatography (HPLC)

    • Liquid chromatography-mass spectrometry (LC-MS)

  • Comparison with controls: Compare results with non-transfected cells or cells expressing enzymatically inactive FA2H mutants to establish baseline levels and confirm specific activity.

When designing these assays, researchers should consider the substrate specificity of FA2H, which has been shown to hydroxylate various fatty acid chain lengths including C16, C18, C24, and C24:1 .

What are the molecular mechanisms underlying FAHN pathophysiology?

Recent studies using Drosophila and patient-derived fibroblasts have revealed several cellular mechanisms that may contribute to FAHN pathophysiology:

  • Mitochondrial dysfunction: Loss of FA2H leads to changes in mitochondrial morphology, reduced mitochondrial density, and decreased interconnectivity . These changes may contribute to energy deficits in neurons and other cells.

  • Altered autophagy: FA2H-deficient models show abnormal levels of LC3-II, indicating dysregulation of the autophagy pathway . This may affect cellular quality control mechanisms and the clearance of damaged organelles.

  • Sphingolipid metabolism disruption: As FA2H is involved in sphingolipid metabolism, its loss likely alters the sphingolipid composition of cellular membranes, potentially affecting membrane properties and signaling pathways .

These mechanisms appear to be evolutionarily conserved, as they have been observed in both Drosophila models and patient-derived fibroblasts . Importantly, the expression of human FA2H in FA2H-deficient Drosophila partially or fully rescues these phenotypes, confirming that these effects are directly caused by the absence of FA2H .

The interplay between these mechanisms may be particularly relevant, as ceramide accumulation has been linked to ceramide-induced mitophagy (the autophagy of mitochondria) . Further research is needed to fully elucidate how alterations in sphingolipid metabolism following loss of FA2H modify these cellular processes.

How can patient-derived fibroblasts be used to study FA2H function?

Patient-derived fibroblasts represent a valuable tool for studying FA2H function and FAHN pathophysiology in a human cellular context. The following methodological approach has been validated:

  • Sample collection and ethical considerations: Obtain skin biopsies from FAHN patients and control subjects following appropriate ethical approvals. For instance, studies have been conducted with approval from institutional review boards (e.g., the University of Lübeck, protocol code 05-030) with proper informed consent .

  • Fibroblast culture: Establish primary fibroblast cultures using standard techniques and maintain them in appropriate growth media.

  • Phenotypic characterization: Analyze cellular phenotypes associated with FA2H deficiency, including:

    • Mitochondrial morphology and function using fluorescent markers like ATP5a

    • Autophagy markers such as LC3-II levels

    • Sphingolipid composition using lipidomic approaches

  • Rescue experiments: Perform genetic rescue by overexpressing wild-type human FA2H in patient-derived fibroblasts to confirm the specificity of the observed phenotypes.

  • Comparative analysis: Compare results from patient-derived fibroblasts with those from animal models to identify evolutionarily conserved mechanisms.

This approach has successfully demonstrated that cellular processes affected by loss of FA2H, such as mitochondrial dysfunction and altered autophagy, are conserved between Drosophila models and human cells .

What genetic approaches can be used to study FA2H function in Drosophila?

The Drosophila FAHN model has emerged as a powerful tool for investigating FA2H function and FAHN pathophysiology. Researchers can employ the following genetic approaches:

  • Loss-of-function models: Several Drosophila lines with dfa2h deficiency have been characterized, including:

    • PBac{RB}fa2h(e00486) (dfa2h1)

    • PBac{WH}fa2h(f01498) (dfa2h2)

    • Compound heterozygous mutants (dfa2h1/dfa2h2)

  • Phenotypic characterization: Analyze behavioral phenotypes such as:

    • Lifespan determination

    • Locomotor function assessment

    • Flight ability testing

    • Wing positioning evaluation

  • Cellular analysis:

    • Immunolabeling of mitochondria using markers like ATP5a to assess mitochondrial density and morphology

    • Analysis of autophagy markers like dLC3 in larval muscle cells

    • Assessment of mitochondrial interconnectivity

  • Rescue experiments: Overexpress human FA2H in dfa2h-deficient flies to validate that observed phenotypes are specifically due to loss of dfa2h function. This approach has successfully demonstrated that human FA2H can rescue behavioral abnormalities, autophagy defects, and mitochondrial abnormalities in dfa2h-deficient flies .

  • Drug screening: The established Drosophila model can be used for high-throughput screening of compounds that might ameliorate FAHN-associated phenotypes.

This comprehensive genetic toolkit allows researchers to gain insights into the cellular dysfunction mechanisms associated with FA2H deficiency and to identify potential therapeutic targets for FAHN treatment.

How can the interplay between FA2H, sphingolipid metabolism, and mitochondrial function be investigated?

Understanding the complex relationship between FA2H activity, sphingolipid metabolism, and mitochondrial function requires integrated experimental approaches:

  • Lipidomic analysis: Characterize the sphingolipid composition of cellular membranes, particularly mitochondrial membranes, in FA2H-deficient models versus controls using mass spectrometry-based approaches.

  • Mitochondrial function assessment:

    • Membrane potential measurements

    • Oxygen consumption rate determination

    • ATP production quantification

    • Reactive oxygen species (ROS) levels

    • Mitochondrial morphology analysis using fluorescent markers and confocal microscopy

  • Mitophagy analysis: Investigate whether alterations in sphingolipid composition following loss of FA2H affect mitophagy processes, as ceramide accumulation has been linked to ceramide-induced mitophagy .

  • Rescue experiments with specific sphingolipids: Test whether supplementation with specific 2-hydroxysphingolipids can rescue mitochondrial defects in FA2H-deficient models.

  • Genetic interaction studies: Introduce additional genetic modifications affecting sphingolipid metabolism or mitochondrial function in FA2H-deficient backgrounds to identify synergistic or antagonistic effects.

Research has shown connections between impaired mitochondria and ceramide accumulation in other neurodegenerative disease models, such as in a loss of Pink1 fly model of Parkinson's disease . Similar mechanisms may be at play in FAHN, where altered sphingolipid metabolism due to FA2H deficiency could impact mitochondrial function and turnover through effects on mitophagy.

How can FA2H research contribute to therapeutic development for FAHN?

Translating basic research on FA2H into therapeutic strategies for FAHN requires several methodological approaches:

  • Target identification: Use model organisms, particularly the Drosophila FAHN model, to identify cellular processes affected by FA2H deficiency that could be targeted therapeutically. Current research highlights mitochondrial dysfunction and altered autophagy as potential therapeutic targets .

  • Drug screening platforms: Develop high-throughput screening assays using established model organisms to identify compounds that ameliorate FA2H deficiency phenotypes. The Drosophila model is particularly suitable for this purpose, as it exhibits multiple behavioral and cellular phenotypes that can be quantitatively assessed .

  • Gene therapy approaches: Investigate the feasibility of gene replacement therapy for FAHN, based on the observation that expression of human FA2H in dfa2h-deficient flies successfully rescues behavioral abnormalities and cellular defects .

  • Sphingolipid replacement strategies: Explore whether supplementation with specific 2-hydroxysphingolipids could compensate for the deficiency in FA2H activity and ameliorate disease phenotypes.

  • Clinical biomarker development: Identify biomarkers of disease progression and treatment response that could be used in clinical trials, potentially based on the cellular mechanisms identified in model organisms and patient-derived fibroblasts.

The demonstrated evolutionary conservation of FA2H function between flies and humans supports the translational relevance of findings from model organisms to human disease , increasing the likelihood that therapeutic strategies developed in these models could be effective in FAHN patients.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.