Recombinant Human Fatty acid desaturase 2-like protein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role of Recombinant Human Fatty Acid Desaturase 2-like Protein

Recombinant Human Fatty Acid Desaturase 2 (FADS2) is a bioengineered enzyme produced via heterologous expression systems (e.g., E. coli or insect cells) to mimic the native human protein’s structure and function . It belongs to the fatty acid desaturase family and plays a critical role in the biosynthesis of polyunsaturated fatty acids (PUFAs), particularly as the rate-limiting enzyme for converting linoleic acid (LA, 18:2n-6) and alpha-linolenic acid (ALA, 18:3n-3) into gamma-linolenic acid (GLA, 18:3n-6) and stearidonic acid (SDA, 18:4n-3) . FADS2 also introduces double bonds into palmitate, producing sapienate, a major component of sebum .

Production and Purification Methods

Recombinant FADS2 is synthesized in prokaryotic (e.g., E. coli) or eukaryotic (e.g., insect cells) systems, followed by affinity chromatography for His-tagged proteins. Key parameters include:

ParameterDetailsSource
Host OrganismE. coli (e.g., BL21(DE3) strain) or insect cells (Sf9)
Purity>90% via SDS-PAGE (monomeric and oligomeric forms detected)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
StabilityLyophilized powder stored at -20°C/-80°C to prevent aggregation

Role in PUFA Biosynthesis

FADS2 catalyzes the first step in long-chain PUFA (LC-PUFA) synthesis, converting:

  • LA → GLA (ω-6 pathway)

  • ALA → SDA (ω-3 pathway)
    These intermediates are further elongated into arachidonic acid (AA) and docosahexaenoic acid (DHA) .

Implications in Cancer Metabolism

FADS2 overexpression is linked to tumor growth, inflammation, and radioresistance in cancers such as lung, melanoma, and glioblastoma . Key findings include:

  • Tumor Growth: FADS2 inhibition reduces AA-derived proinflammatory metabolites (e.g., PGE2) and angiogenesis factors (e.g., VEGF) .

  • Survival Correlation: High FADS2 expression correlates with poor prognosis in lung cancer patients .

  • Ferroptosis Regulation: FADS2 knockdown increases lipid ROS (reactive oxygen species) and ferroptosis in lung cancer cells .

Research Tools

Recombinant FADS2 is used in:

  1. Enzymatic Assays: Measuring desaturation efficiency (e.g., GLA/LA ratios) .

  2. Drug Development: Testing inhibitors like SC-26196 to block AA synthesis .

  3. Structural Studies: Analyzing oligomerization patterns (homodimers and higher-order complexes) .

Comparative Analysis of FADS2 and Related Desaturases

EnzymePrimary SubstrateKey ProductTissue ExpressionSource
FADS2LA, ALA, palmitateGLA, SDA, sapienateLiver, brain, pancreas
SCD2Stearoyl-CoA, palmitoyl-CoAOleic acid, palmitoleic acidPancreas, brain

Challenges and Future Directions

  • Enzymatic Stability: Recombinant FADS2 requires careful handling to prevent aggregation .

  • Therapeutic Targeting: Developing isoform-specific inhibitors to minimize off-target effects in cancer treatment .

  • Evolutionary Insights: Investigating FADS2’s dual Δ6/Δ8 activity in fish for LC-PUFA production strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your preferred format during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For convenience, it is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard protocol utilizes a final glycerol concentration of 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain their stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize its development for your protein.
Synonyms
FADS2B; FADS2P1; Putative fatty acid desaturase 2-like protein FADS2B; Fatty acid desaturase 2 pseudogene 1; Fatty acid desaturase 2B, pseudogene
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-482
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FADS2P1
Target Protein Sequence
MKFEEKCGDNGSIVGRNQSYPGEKHQPKGKPIANGEAEVYAKQEANGKCSTPRKSLSMYT WLEIQRHNHEADQLVINCKVYNVSSWADRHPGGHQVLNHCAGEDAMDVFRAMHPELDIVQ LYLKPLLIGELAPGEPSQERHKNSQLVKDFQELWSIAEAMNMFHANLGFFFLHFVQILIL EVLAWLIVYHFGSGWPVTMFISFLLTISQASSSFLQHDAGHLSIFRKSKWNHVVHKFVMC HLKGLSADRWNYWHFEQHVKPNIYPKDPDIDTDPLFLLGDSQPVKYGKKKIKYINYEEQH LYFYKVWLPLFMPVYLKLPSMQAMYLQRYWVCFSLQDITWVSSFYIYFITFGLYYGIFGT MLLIYLVKFLESPWIVYVTQMSHITMRMSTEENRDWLTTQVLATCNTESFFNDFTGHLNF QIEHHLFPTMPRHNYHKVAPLVRSLCAKHGLHYVNKPMLRAFGDIVRALKKSAALWADAY YE
Uniprot No.

Target Background

Database Links

HGNC: 43618

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of recombinant human FADS2?

Recombinant human FADS2 (Fatty Acid Desaturase 2), also known as Delta-6 desaturase, is a 444-amino acid transmembrane protein that catalyzes the rate-limiting step in converting omega-6 and omega-3 precursors to their respective long-chain polyunsaturated fatty acids (LC-PUFAs). The enzyme specifically inserts a cis double bond at position 6 of the fatty acid chain, converting linoleic acid to gamma-linolenic acid and alpha-linolenic acid to stearidonic acid . This desaturation function is essential for the biosynthesis of physiologically important fatty acids including arachidonic acid and docosahexaenoic acid. FADS2 also possesses the ability to catalyze secondary desaturation of 24-carbon LC-PUFA intermediates following chain elongation, demonstrating its multifunctional role in fatty acid metabolism .

How does the structure of FADS2 relate to its function?

FADS2, like other membrane-bound desaturases, contains a characteristic diiron active site that enables oxygen-dependent dehydrogenation reactions. The protein features a transmembrane domain that anchors it to the endoplasmic reticulum and a cytosolic domain containing the catalytic machinery . Homology modeling studies, similar to those conducted with plant FADs, suggest that FADS2 contains a central binding pocket with histidine motifs surrounding the diiron core . These histidine residues coordinate the iron atoms and are essential for electron transfer during catalysis. The protein's structure includes a binding pocket that accommodates fatty acid substrates of specific lengths and geometries, with the active site positioned to facilitate selective desaturation at the Delta-6 position . This structure-function relationship is critical for understanding substrate specificity and developing strategies to modulate FADS2 activity.

What are the optimal storage and handling conditions for recombinant FADS2?

Recombinant FADS2 proteins require specific storage and handling conditions to maintain their structural integrity and enzymatic activity. Based on protocols for similar desaturases, recombinant FADS2 should typically be stored at -20°C or -80°C for long-term preservation . For working solutions, it's recommended to aliquot the protein to avoid repeated freeze-thaw cycles that can compromise activity . When handling the protein, researchers should maintain sterile conditions and consider using buffers containing reducing agents (such as DTT) to protect sulfhydryl groups from oxidation . For reconstitution, PBS or similar physiological buffers are typically recommended, and stability studies indicate that properly stored recombinant desaturases maintain >95% activity within their expiration period when stored according to manufacturer recommendations .

What analytical methods are used to assess recombinant FADS2 activity?

Several methodological approaches can be employed to assess recombinant FADS2 activity:

  • Gas Chromatography-Mass Spectrometry (GC-MS): This technique allows for the quantification of substrate conversion rates by measuring the appearance of desaturated products and disappearance of substrates.

  • Spectrophotometric Assays: These monitor electron transfer during desaturation by coupling the reaction to indicators that change absorbance upon reduction or oxidation.

  • Radioisotope Incorporation: Using radiolabeled substrates to track conversion to desaturated products.

  • Western Blotting: While not directly measuring enzymatic activity, this technique confirms the presence and integrity of the recombinant protein using specific antibodies .

  • UV-Vis Spectroscopy: Similar to methods used for FAD synthase, this can be used to determine the ratio of bound cofactors to protein monomers .

The choice of method depends on the specific research question, available equipment, and desired sensitivity and specificity of the assay.

How does the diiron active site mechanism of FADS2 compare to other desaturases?

The diiron active site of FADS2 operates through a mechanism similar to other membrane-bound desaturases but with distinct substrate specificity. Desaturases perform O₂-dependent dehydrogenations initiated at unactivated C-H groups using a diiron active site . The reaction mechanism involves several steps: binding of the fatty acid substrate, activation of oxygen by the diiron center, abstraction of a hydrogen atom from the substrate to form a carbon radical, and subsequent electron transfer leading to double bond formation.

Comparative analysis between FADS2 and related desaturases such as FADS1 (Delta-5 desaturase) reveals differences in the coordination geometry of the diiron center and surrounding amino acids that influence substrate positioning and specificity . Research on desaturase crystal structures has enabled structural comparison of the active sites of disparate diiron enzymes, providing insights into how these similar catalytic centers are tuned for different substrates and reactions . The diiron center's tuning involves specific arrangements of histidine residues and other coordinating amino acids, creating distinct electronic environments that favor particular reaction pathways.

What are the methodological approaches for expressing functional recombinant FADS2?

Expressing functional recombinant FADS2 presents several challenges due to its membrane-associated nature and requirement for cofactors. Successful expression strategies include:

  • Selection of Expression System: While E. coli systems are commonly used for initial expression studies , eukaryotic systems such as yeast, insect cells, or mammalian cells may yield more functionally active protein due to proper post-translational modifications and membrane integration.

  • Construct Design: For full functionality, the construct should include the complete coding sequence or at minimum the critical catalytic domain with the diiron center. Some research applications utilize the N-terminal cytoplasmic domain (residues 2-131) of FADS2 .

  • Optimization of Expression Conditions: This includes adjusting temperature, induction parameters, and culture media composition to increase yield and proper folding.

  • Purification Strategy: Affinity tags (such as His-tag) facilitate purification while minimizing impact on function . For membrane proteins like FADS2, detergent selection during solubilization is critical.

  • Reconstitution Methods: For functional studies, recombinant FADS2 may need to be reconstituted into artificial membrane systems or liposomes to replicate its native environment.

Similar approaches to those used for human FAD synthase isoforms could be adapted, as described in reference studies where heterologous overexpression protocols were optimized .

How can researchers assess substrate specificity of recombinant FADS2 variants?

Substrate specificity assessment of recombinant FADS2 variants requires systematic experimental approaches:

MethodologyDescriptionAdvantagesLimitations
Enzymatic Assays with Multiple SubstratesTesting activity against a panel of fatty acids with varying chain lengths and existing desaturation patternsProvides direct comparative data on specificityRequires multiple substrate preparations
Site-Directed MutagenesisIntroducing specific amino acid changes in the binding pocket to alter substrate interactionsIdentifies key residues involved in specificityLabor-intensive and requires structure knowledge
Molecular Docking SimulationsIn silico prediction of binding affinities for different substratesRapid screening of multiple substratesRequires validated structural models
Competitive Inhibition StudiesMeasuring enzyme activity with primary substrate in presence of potential competitorsReveals relative binding affinitiesIndirect measure of specificity

The molecular docking approach, similar to that used in plant FAD studies, has shown that binding affinity varies with carbon chain length, with a notable dip in affinity near the 18:2 carbon chain length . When conducting these assessments, researchers should control for experimental variables including temperature, pH, cofactor availability, and membrane/detergent environment, as these can significantly impact substrate binding and catalytic efficiency.

What are the structural determinants of FADS2 regioselectivity?

The regioselectivity of FADS2—its ability to introduce double bonds at specific positions (primarily Delta-6)—is determined by several structural features:

  • Binding Pocket Architecture: The three-dimensional arrangement of the substrate binding channel positions the fatty acid with precise orientation relative to the diiron catalytic center. Homology modeling studies based on crystal structures of related desaturases have identified key residues that form the substrate binding pocket .

  • Diiron Center Positioning: The distance between the diiron center and specific carbon atoms in the substrate influences which C-H bond undergoes desaturation. In FADS2, this positioning favors the C6 position of fatty acid substrates.

  • Cytosolic Cap Domain: Molecular dynamics analyses have highlighted the importance of regions within the cytosolic cap domain that influence the binding pocket conformation and substrate positioning . These regions may undergo conformational changes during substrate binding to properly align the substrate.

  • Conserved Histidine Motifs: The arrangement of histidine residues coordinating the diiron center creates an electronic environment that favors specific reaction pathways. The 8-histidine motif expected in desaturases utilizing a diiron core is consistent with the structure predicted for FADS2 .

Understanding these structural determinants provides insights for protein engineering efforts aimed at altering regioselectivity for biotechnological applications or studying structure-function relationships.

How do post-translational modifications affect recombinant FADS2 activity?

Post-translational modifications (PTMs) can significantly impact FADS2 activity, although this aspect is often overlooked in recombinant protein studies. When working with recombinant FADS2, researchers should consider:

  • Phosphorylation: Phosphorylation of specific serine, threonine, or tyrosine residues may regulate enzyme activity by inducing conformational changes or altering substrate binding. Expression systems differ in their phosphorylation patterns, potentially affecting recombinant protein activity.

  • Glycosylation: Although less common for intracellular domains of membrane proteins, glycosylation might affect protein folding and stability. Prokaryotic expression systems like E. coli lack glycosylation machinery, potentially impacting protein behavior compared to native FADS2 .

  • Disulfide Bond Formation: Proper formation of disulfide bonds is critical for structural integrity and is influenced by the redox environment during expression and purification. Including reducing agents like DTT in buffer formulations may help maintain proper disulfide status .

  • Lipid Modifications: Association with specific lipids may influence enzyme activity and membrane association. The lipid environment provided during reconstitution experiments can significantly impact activity measurements.

Methodological approaches to address PTM effects include comparing proteins expressed in different systems, site-directed mutagenesis of potential modification sites, and mass spectrometry analysis to identify and quantify modifications. When interpreting activity data from recombinant FADS2, researchers should consider potential differences in PTMs compared to the native enzyme.

How can recombinant FADS2 be used in metabolic pathway engineering?

Recombinant FADS2 serves as a valuable tool in metabolic pathway engineering aimed at modifying fatty acid compositions for research or biotechnological applications. Methodological approaches include:

  • Heterologous Expression Systems: Introducing recombinant FADS2 into organisms that lack Delta-6 desaturase activity enables the production of polyunsaturated fatty acids not naturally synthesized by the host. This approach has been used to engineer plants, yeast, and bacteria to produce valuable omega-3 and omega-6 fatty acids.

  • Pathway Reconstruction: Combining FADS2 with other enzymes involved in PUFA biosynthesis (elongases, other desaturases) allows for the complete reconstruction of PUFA pathways in heterologous systems. This enables the study of pathway regulation and the optimization of PUFA production.

  • Structure-Function Studies: Site-directed mutagenesis of recombinant FADS2 can generate variants with altered substrate specificity or regioselectivity, similar to studies conducted with castor desaturase mutants that provided insights into substrate-binding modes and catalytic outcomes .

  • Protein Engineering: Knowledge gained from homology models of desaturases can inform protein engineering efforts to create FADS2 variants with improved stability, activity, or novel functionalities .

When implementing these approaches, researchers should carefully consider the cellular context, including cofactor availability, electron transport systems, and membrane composition, as these factors significantly influence FADS2 function in engineered systems.

What are the experimental considerations for studying FADS2 and FADS1 interactions?

FADS2 and FADS1 (Delta-5 desaturase) operate sequentially in the biosynthesis of long-chain polyunsaturated fatty acids, making their interaction and coordinated function physiologically relevant. When studying these interactions, researchers should consider:

  • Co-expression Systems: Developing experimental systems where both enzymes are co-expressed allows for the study of their coordinated action in fatty acid modification pathways. This requires careful design of expression constructs and selection of appropriate host systems.

  • Substrate Channeling: Investigating whether intermediates are directly transferred between FADS2 and FADS1 (substrate channeling) requires specialized experimental approaches, such as using linked enzyme constructs or membrane reconstitution systems that preserve spatial relationships.

  • Regulatory Cross-talk: Examining whether the activity of one enzyme affects the other through allosteric mechanisms or by influencing shared regulatory pathways. This may involve activity assays under various conditions and with different substrate concentrations.

  • Competitive Interactions: Since both enzymes require similar electron transport systems and may compete for cellular resources, studying their activity ratios and how they influence pathway flux is important for understanding PUFA biosynthesis regulation.

Approaches used in studying FAD synthase isoforms, which also exhibit complex interactions, could be adapted for FADS1/FADS2 interaction studies, including purification of recombinant proteins and quantitative analysis of their activities under various conditions .

How can researchers develop high-throughput screening assays for FADS2 modulators?

Developing high-throughput screening (HTS) assays for identifying FADS2 modulators requires balancing throughput with biological relevance. Methodological considerations include:

  • Activity-Based Fluorescent Assays: Developing fluorescent reporter systems that respond to changes in membrane fluidity or directly detect desaturated products can enable rapid screening of compound libraries.

  • Coupled Enzyme Assays: Linking FADS2 activity to enzymes that produce detectable signals (e.g., colorimetric or luminescent) allows for adaptation to plate-based formats suitable for HTS.

  • Cell-Based Reporter Systems: Engineering cells to express FADS2 along with reporter constructs that respond to changes in PUFA levels or FADS2 activity provides a more physiologically relevant screening platform.

  • Mass Spectrometry-Based Methods: While traditionally lower throughput, advances in MS technology now allow for faster analysis of fatty acid profiles, making it feasible for screening applications.

  • In Silico Pre-Screening: Using the knowledge gained from homology models and molecular docking studies to pre-screen compound libraries before experimental testing can enhance efficiency .

When implementing these assays, researchers should establish appropriate positive and negative controls, validate hit compounds in secondary assays, and consider the potential impact of the screening system (e.g., membrane environment, cofactor availability) on assay performance and physiological relevance.

What are emerging technologies for studying FADS2 structure-function relationships?

Several cutting-edge technologies are advancing our understanding of FADS2 structure-function relationships:

  • Cryo-Electron Microscopy: While crystal structures of related desaturases have been determined , cryo-EM offers the potential to resolve FADS2 structure in its native membrane environment, providing insights into conformational dynamics during catalysis.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify flexible regions and conformational changes upon substrate binding, providing dynamic structural information complementary to static structures.

  • Molecular Dynamics Simulations: Advanced computational simulations using homology models can predict how substrate binding affects protein dynamics and identify potential allosteric sites .

  • Single-Molecule Techniques: Emerging methods for studying single enzyme molecules could reveal heterogeneity in FADS2 behavior and capture transient conformational states during catalysis.

  • Data-Driven Modeling Approaches: Combining experimental data with computational tools allows for more accurate prediction of protein function from sequence, as demonstrated in plant FAD studies .

These technologies promise to overcome the limitations of traditional structural biology approaches for membrane proteins like FADS2 and provide unprecedented insights into how these enzymes achieve their remarkable catalytic specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.