Recombinant Human Fatty acid desaturase 3 (FADS3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoted for storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please communicate them to us, and we will prioritize development of the specified tag.
Synonyms
FADS3; CYB5RP; Fatty acid desaturase 3; Delta(13 fatty acid desaturase; Delta(13 desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FADS3
Target Protein Sequence
MGGVGEPGPREGPAQPGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSR LIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVEDFRALHQ AAEDMKLFDASPTFFAFLLGHILAMEVLAWLLIYLLGPGWVPSALAAFILAISQAQSWCL QHDLGHASIFKKSWWNHVAQKFVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVTVAPV FLLGESSVEYGKKKRRYLPYNQQHLYFFLIGPPLLTLVNFEVENLAYMLVCMQWADLLWA ASFYARFFLSYLPFYGVPGVLLFFVAVRVLESHWFVWITQMNHIPKEIGHEKHRDWVSSQ LAATCNVEPSLFTNWFSGHLNFQIEHHLFPRMPRHNYSRVAPLVKSLCAKHGLSYEVKPF LTALVDIVRSLKKSGDIWLDAYLHQ
Uniprot No.

Target Background

Function
Mammals possess a diverse array of sphingoid bases, varying in length and/or degree of desaturation and hydroxyl groups. The predominant sphingoid base in mammalian ceramides is sphing-4-enine (sphingosine or SPH), characterized by a trans desaturation at carbon 4. FADS3, a ceramide desaturase, introduces a cis double bond between carbon 14 and carbon 15 of SPH-containing ceramides, generating sphinga-4,14-dienine-containing ceramides (SPD ceramides). SPD ceramides are widely distributed across mammalian tissues and cells. Their unique structure, containing a cis double bond, suggests a potential opposing, negative role in lipid microdomain formation compared to conventional ceramides. FADS3 also functions as a methyl-end fatty acyl coenzyme A (CoA) desaturase, introducing a cis double bond between the existing double bond and the terminal methyl group of the fatty acyl chain. It desaturates (11E)-octadecenoate (trans-vaccenoate, the primary trans fatty acid in human milk) at carbon 13, yielding (11E,13Z)-octadecadienoate (also known as conjugated linoleic acid 11E,13Z-CLA).
Gene References Into Functions
  1. Research indicates that the rs1000778-G allele in the FADS3 gene is associated with an elevated risk for coronary artery disease in the northern Chinese Han population. PMID: 28237083
  2. Pairwise comparisons revealed that individuals homozygous for the SNP rs1000778 in the FADS3 gene exhibited lower concentrations of α-linolenic acid and linoleic acid in their breast milk. PMID: 27269715
  3. Homozygotes and heterozygotes carrying the minor allele of rs174455 in the FADS3 gene displayed reduced levels of 22:5 omega-3, 20:4 omega-6, and Delta5-desaturase activity in individuals with type 2 diabetes mellitus. PMID: 24985009
  4. Studies suggest that FADS3 alternative transcripts/splicing are upregulated in the liver by dietary docosahexaenoic/arachidonic acids through a peroxisome proliferator-activated receptor gamma (PPARγ)-dependent mechanism, independent of other desaturases (FADS1/2). PMID: 22398025
  5. A genetic association study conducted on maternal/child dyads in England indicated that SNPs in FADS3 (and in FADS1/FADS2) influence fetal fatty acid metabolism. Both maternal and child FADS genotypes/haplotypes influence cord plasma long-chain fatty acids. PMID: 22877655
  6. Strong evidence suggests that a gene product of FADS3 possesses desaturating activity. PMID: 21366865
  7. FADS3 exists in multiple protein isoforms depending on the specific mammalian tissue. PMID: 19752397
  8. USF1 and FADS3 are identified as candidate causal genes for Mexican familial combined hyperlipidemia. PMID: 19750004

Show More

Hide All

Database Links

HGNC: 3576

OMIM: 606150

KEGG: hsa:3995

STRING: 9606.ENSP00000278829

UniGene: Hs.21765

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in various organs and tissues including liver, kidney, brain, lung, pancreas, testis, ovary and skeletal muscle (at protein level).

Q&A

What is FADS3 and how does it differ structurally from other FADS family members?

FADS3 is the third member of the Fatty Acid Desaturase (FADS) gene cluster, alongside FADS1 and FADS2, which respectively code for Δ5- and Δ6-desaturases. FADS3 shares significant sequence homology with its family members, revealing 62% nucleotide sequence identity with FADS1 and 70% with FADS2 . Like other membrane-bound front-end desaturases, FADS3 possesses characteristic conserved motifs including:

  • A "HPGG" cytochrome b5-like domain

  • Three histidine-rich motifs: "HDLGH," "HFQHH," and "QIEHH"

These structural features are essential for its catalytic function. Unlike FADS1 and FADS2, whose enzymatic roles were well-characterized early on, FADS3 function remained unassigned for a decade after its discovery until it was identified as having specific Δ13-desaturase activity on trans-vaccenic acid .

What enzymatic activities have been attributed to FADS3?

Research has revealed that FADS3 possesses multiple desaturase activities:

  • Δ13-desaturase activity: FADS3 catalyzes the desaturation of trans-vaccenic acid (trans-11-18:1) to produce trans-11,cis-13-conjugated linoleic acid isomer .

  • Δ14Z sphingoid base desaturase activity: FADS3 introduces a second double bond at the Δ14Z position in long-chain bases (LCBs), converting sphinganine (d18:1) with its existing Δ4E double bond into sphingadienine (d18:2) .

This dual functionality makes FADS3 unique among desaturases, as it can act on both fatty acids and sphingoid bases, contributing to both conventional fatty acid metabolism and sphingolipid diversity.

How is FADS3 expression regulated in different physiological contexts?

FADS3 expression is regulated through several mechanisms:

  • Hormone-dependent regulation:

    • Estrogen significantly stimulates FADS3 expression through ERα-dependent pathways

    • Progesterone increases FADS3 expression via progesterone receptor-dependent mechanisms

  • Pregnancy and implantation:

    • FADS3 is highly expressed at embryo implantation sites in mouse uterus

    • Expression is significantly detected in decidual cells during days 6-8 of pregnancy

    • Expression is embryo-dependent, as it is not detected at inter-implantation sites or in pseudopregnant uteri

  • Developmental regulation:

    • FADS3 is downregulated during human neurogenic differentiation

    • Expression levels vary across tissues with developmental stage

  • Compensatory regulation:

    • Upregulation of FADS3 occurs in the liver of FADS2-knockout mice, suggesting compensatory mechanisms

What methods are available for detecting and measuring FADS3 levels?

Several methodological approaches have been validated for FADS3 detection:

MethodApplicationsAdvantagesLimitations
qRT-PCRmRNA expression analysisHigh sensitivity, quantitativeDoes not detect protein levels
In situ hybridizationTissue localization of mRNASpatial distribution in tissuesLabor-intensive, semi-quantitative
Western blotProtein detectionConfirms translation, size verificationRequires specific antibodies
ELISAQuantification in biological samplesHigh sensitivity (0.425 ng/mL), quantitativeLimited to protein detection
ImmunohistochemistryProtein localization in tissuesVisual confirmation of expression patternSemi-quantitative

For recombinant FADS3 studies, anti-FADS3 antibodies against specific peptide sequences have been developed. For example, antibodies targeting the N-terminal sequence (31QIRQHDLPGDKWL) and C-terminal sequence (352PKEIGHEKHRDWAS) of rat FADS3 .

What are the known alternative transcripts of FADS3 and their functional implications?

FADS3 exhibits significant transcript diversity through alternative splicing. Eight alternative transcripts (AT) have been identified :

TranscriptSizeExons AffectedPredicted Protein ImpactConserved Motifs
Classical1.34 kbNoneFull-length proteinAll conserved motifs intact
AT11.14 kbLacks exon 3In-frame loss of 66 aaAll motifs retained
AT20.77 kbLacks exon 6Truncated (257 aa), frameshiftLast histidine repeat "QIEHH" lost
AT31.25 kbPartial loss of exon 3In-frame loss of 28 aaAll motifs retained
AT40.51 kbMultiple exon deletionsTruncated"HPGG" and "QIEHH" lost
AT50.51 kbMultiple, termination in intron 8-9Truncated"HPGG," "HDLGH," and "QIEHH" lost
AT60.74 kbMultiple exon deletionsTruncatedOnly "HPGG" retained, all histidine repeats lost
AT71.11 kbPartial loss of exon 8, lacks exons 9-10In-frame loss of 76 aaLast histidine repeat "QIEHH" lost

These alternative transcripts may have different substrate specificities despite sharing some catalytic domains . Research suggests that transcripts like AT1, AT3, and AT7, which maintain the reading frame, are likely to produce functional but potentially altered desaturase activities. The biological significance of this transcript diversity remains a subject of ongoing investigation.

What experimental approaches have been used to characterize FADS3 enzymatic activity?

Several complementary approaches have been employed to characterize FADS3 function:

  • Overexpression systems:

    • Transfection of FADS3 cDNA into HEK293 cells

    • Addition of potential substrates to culture medium

    • LC-MS analysis of metabolites

  • Knockdown experiments:

    • siRNA-mediated silencing in HeLa cells (which express endogenous FADS3)

    • Analysis of substrate conversion efficiency

  • Cell-free assays:

    • Preparation of cell-free extracts from FADS3-expressing cells

    • Addition of free or N-acylated substrates

    • Analysis of conversion to dienic forms

  • Metabolic labeling:

    • Use of deuterium-labeled substrates ((d7)d18:1)

    • Tracking conversion to labeled products ((d7)d18:2)

    • With/without inhibitors like fumonisin B1 (FB1)

  • In vivo validation:

    • Analysis of FADS3 function in appropriate animal models

    • Correlation of genetic variants with metabolic profiles in human cohorts

These methodologies collectively established FADS3's dual functionality as both a Δ13-desaturase for trans-vaccenic acid and a Δ14Z sphingoid base desaturase.

How does FADS3 function in decidualization and embryo implantation?

FADS3 plays a critical role in decidualization, the process where endometrial stromal cells transform to support embryo implantation:

  • Expression pattern:

    • FADS3 is specifically expressed in subluminal stromal cells at implantation sites on day 5 of pregnancy

    • Expression increases significantly in decidua from days 6-8

  • Functional evidence:

    • Knockdown of FADS3 by siRNA significantly reduces expression of decidualization markers (Dtprp, Prl3c1, and Bmp8a)

    • FADS3 knockdown also reduces Abp1 expression, which is essential for embryo implantation

  • Proposed mechanism:

    • FADS3 may contribute to arachidonic acid metabolism

    • This pathway activates the cytosolic phospholipase A2a/cyclooxygenase-2 (COX2) pathway

    • Balanced arachidonic acid levels are essential for decidual development

The critical importance of FADS3 in this process is evidenced by its embryo-dependent expression and the significant reduction in decidualization markers following its knockdown, suggesting it as a potential therapeutic target for implantation disorders.

What is the evidence for FADS3's role as a Δ14Z sphingoid base desaturase and its impact on sphingolipid metabolism?

FADS3's function as a Δ14Z sphingoid base desaturase was established through comprehensive investigations:

  • Metabolic profiling:

    • Analysis of a gender-, age-, and BMI-matched subgroup from the CoLaus cohort revealed FADS3 is strongly associated with dienic sphingolipid levels

  • Gain and loss of function studies:

    • FADS3 overexpression in HEK cells significantly increased conversion of d18:1 to d18:2 sphingoid bases

    • siRNA knockdown of FADS3 in HeLa cells reduced this conversion

  • Substrate specificity analysis:

    • FADS3 can process both free LCBs and N-acylated sphingolipids

    • FB1 treatment reduced but did not eliminate conversion, confirming FADS3 acts on both forms

  • Cell-free assays:

    • Cell extracts from FADS3-expressing cells converted both free (d7)d18:1 and N-acylated d18:1/6:0 to their dienic forms

The impact on sphingolipid metabolism is significant as dienic sphingolipids (d18:2-based) have distinct biophysical properties from monounsaturated variants, affecting membrane dynamics, signaling pathways, and potentially disease processes. This discovery explains previously observed associations between FADS3 and sphingolipid species in genome-wide association studies .

How does FADS3 overexpression contribute to poor prognosis in head and neck squamous cell carcinoma?

FADS3 has emerged as a significant prognostic biomarker in HNSCC with multiple lines of evidence:

These findings suggest FADS3 influences HNSCC progression through modulating the immune microenvironment, cell migration, invasion, and altering fatty acid metabolism, making it both a prognostic marker and potential therapeutic target.

What are the current contradictions or gaps in understanding FADS3 function compared to other FADS family members?

Despite significant advances, several important questions remain about FADS3:

  • Evolutionary relevance:

    • Why mammals maintain three FADS genes with distinct substrate specificities

    • Whether FADS3's unusual dual activity on both fatty acids and sphingoid bases serves an integrative metabolic function

  • Regulatory mechanisms:

    • How FADS3 expression and activity are coordinated with FADS1 and FADS2

    • Why FADS3 is upregulated in FADS2-knockout mice, suggesting potential compensatory mechanisms

  • Alternative transcripts functionality:

    • Whether the eight identified FADS3 alternative transcripts have distinct physiological roles

    • How these transcript variants might be differentially regulated in various tissues and conditions

  • Disease associations:

    • While FADS3 polymorphisms correlate with lipid metabolism markers, the mechanisms underlying these associations remain unclear

    • The causal relationship between FADS3 overexpression and cancer progression

  • Therapeutic potential:

    • Whether FADS3 inhibition could be exploited therapeutically in conditions like HNSCC or implantation disorders

    • Potential off-target effects given FADS3's influence on multiple lipid pathways

Future research should address these gaps using integrative approaches combining genetic models, lipidomics, structural biology, and clinical studies to fully elucidate FADS3's complex biology.

What methodological approaches are recommended for analyzing FADS3 genetic variants and their functional impacts?

When investigating FADS3 genetic variants, researchers should consider:

  • Comprehensive variant identification:

    • Whole gene sequencing rather than targeted SNP analysis

    • Assessment of both coding and regulatory regions

    • Consideration of linkage disequilibrium with other FADS cluster genes

  • Functional validation in appropriate systems:

    • Expression of variant forms in cellular models

    • Activity assays using multiple potential substrates

    • Analysis of both fatty acid and sphingolipid metabolism

  • Population-level analysis:

    • Integration of genetic data with lipidomic profiles

    • Consideration of dietary factors that may interact with genetic variants

    • Analysis across diverse ethnic groups due to known variations in FADS cluster genetics

  • Clinical correlation:

    • Association studies with relevant disease endpoints

    • Consideration of interaction with environmental factors

    • Longitudinal studies to assess causality

  • Substrate specificity determination:

    • Development of specific assays for each potential substrate

    • Using labeled substrates to track metabolic fates

    • Analysis of both free and complex lipid forms

This multilayered approach allows for robust characterization of variant effects and their potential clinical significance.

What are the optimal expression systems for producing active recombinant FADS3?

Different expression systems offer distinct advantages for recombinant FADS3 production:

Expression SystemAdvantagesLimitationsApplications
Mammalian (HEK293, HeLa)Native post-translational modifications, proper membrane insertionHigher cost, lower yieldFunctional studies, substrate specificity
Insect cellsHigher protein yield, eukaryotic processingDifferent membrane compositionStructure studies, antibody production
YeastCost-effective, eukaryotic processingDifferent lipid environmentMutational analysis, high-throughput screening
Cell-freeRapid production, avoids toxicity issuesMay lack proper folding for membrane proteinsDomain function analysis

For functional studies, mammalian expression systems are preferred as they provide the correct membrane environment and post-translational modifications essential for FADS3 activity. HEK293 cells have been successfully used to express active FADS3 for enzymatic assays .

The selection of appropriate expression tags, purification strategies, and membrane solubilization methods must be carefully considered to maintain FADS3's desaturase activity, particularly given its multi-pass transmembrane nature and requirement for proper orientation in the endoplasmic reticulum membrane .

What are the current challenges in differentiating between the activities of FADS3 and other desaturases in experimental settings?

Researchers face several methodological challenges when studying FADS3:

  • Substrate overlap:

    • Potential overlap of substrates with other desaturases

    • Need for specific assays that can distinguish between closely related metabolites

  • Detection limitations:

    • Requirement for sensitive analytical methods (LC-MS/MS) to detect and quantify desaturation products

    • Need for appropriate internal standards for accurate quantification

  • Complex lipid environment:

    • Difficulty in controlling the cellular lipid environment

    • Impact of membrane composition on desaturase activity and specificity

  • Variable expression levels:

    • Ensuring consistent expression levels across experimental conditions

    • Accounting for potential compensatory mechanisms between FADS family members

  • Multiple transcript variants:

    • Need to consider the eight alternative transcripts when designing experiments

    • Potential for different variants to have distinct activities

These challenges necessitate careful experimental design, incorporating appropriate controls, and using complementary methodologies to validate findings.

What emerging technologies might advance our understanding of FADS3 biology?

Several cutting-edge approaches could significantly enhance FADS3 research:

  • CRISPR/Cas9 genome editing:

    • Generation of precise FADS3 knockout or knockin models

    • Introduction of specific polymorphisms to study variant effects

    • Creation of reporter systems for real-time activity monitoring

  • Advanced lipidomics:

    • Application of ion mobility-mass spectrometry for improved isomer separation

    • Spatial lipidomics to map FADS3 activity within cellular compartments

    • Single-cell lipidomics to understand cell-specific functions

  • Structural biology approaches:

    • Cryo-EM structures of FADS3 in different conformational states

    • Molecular dynamics simulations to understand substrate binding and catalysis

    • Structure-based design of specific inhibitors or activity modulators

  • Systems biology integration:

    • Multi-omics integration (genomics, transcriptomics, proteomics, lipidomics)

    • Network analysis to understand FADS3's position in lipid metabolism pathways

    • Machine learning approaches to predict FADS3 activity from genetic and environmental data

  • Translational approaches:

    • Development of FADS3-targeted therapeutics for conditions like HNSCC

    • Personalized nutrition recommendations based on FADS3 genetic variants

    • Diagnostic applications using FADS3 as a biomarker

These technologies, particularly when used in combination, promise to resolve many outstanding questions about FADS3 biology and its relevance to human health and disease.

How might FADS3 research impact our understanding of lipid metabolism in health and disease?

FADS3 research has potential to transform several areas:

  • Cancer biology:

    • Understanding how FADS3-mediated lipid modifications contribute to cancer progression and immune evasion in HNSCC and potentially other cancers

    • Development of FADS3 as a prognostic biomarker or therapeutic target

  • Reproductive biology:

    • Clarification of FADS3's role in decidualization and embryo implantation

    • Potential interventions for implantation disorders and early pregnancy complications

  • Neurological development:

    • Investigation of FADS3's role in brain development, given its regulation during neurogenic differentiation

    • Potential implications for cognitive development and neurological disorders

  • Metabolic regulation:

    • Understanding the integrated regulation of fatty acid and sphingolipid metabolism

    • Implications for metabolic diseases and personalized nutrition approaches

  • Inflammatory processes:

    • Elucidation of how FADS3-mediated lipid modifications influence immune cell function and inflammatory responses

    • Potential therapeutic applications in inflammatory disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.