Recombinant Human FERM domain-containing protein 3 (FRMD3)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
FRMD3; EPB41L4O; FERM domain-containing protein 3; Band 4.1-like protein 4O; Ovary type protein 4.1; 4.1O
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-597
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
FRMD3
Target Protein Sequence
MFASCHCVPRGRRTMKMIHFRSSSVKSLSQEMRCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTHPPYTMCFRVKFYPHEPLKIK
EELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANI
TQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEENISAPLISSSPVKA
AREYEDPPSEEEDKIKEEPLTISELVYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLIAEEEELKEARRALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLL
FVFPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKVHLILYMLGCS
Uniprot No.
Target Background
Function
FRMD3 is a putative tumor suppressor gene potentially involved in the initiation and progression of lung cancer.
Gene References Into Functions
FRMD3 Research Highlights:
- A study found no significant difference in the allele frequencies of SNPs (rs1888747 and rs739401) in FRMD3 and CARS between diabetic patients with and without nephropathy (P > 0.05). PMID: 26909942
- A model suggests a potential transcriptional link between FRMD3 polymorphisms and the bone morphogenetic protein (BMP) signaling pathway in diabetic nephropathy. PMID: 23434934
- Research indicates a role for FRMD3 in type 2 diabetes susceptibility in individuals of African ancestry. PMID: 21698141
- Clinical trial data on gene-disease association and gene-environment interaction (HuGE Navigator). PMID: 20379614
- Observational study on gene-disease association (HuGE Navigator). PMID: 20460425
- FRMD3 has been identified as a potential tumor suppressor gene, highlighting its possible role in lung cancer development and progression. PMID: 17260017
- Observational study and genome-wide association study on gene-disease association (HuGE Navigator). PMID: 19252134
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Ovary-specific.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
