Recombinant Human Ferric-chelate reductase 1 (FRRS1)

Shipped with Ice Packs
In Stock

Description

Iron Metabolism

FRRS1 reduces Fe³⁺ to Fe²⁺ at endosomal membranes, enabling iron transport into the cytoplasm via divalent metal transporters . This activity supports:

  • Catecholamine synthesis in the brain

  • Erythropoiesis and systemic iron homeostasis

Disease Associations

  • Cancer: Upregulated in cervical squamous cell carcinoma (SiHa and HeLa cells), where its knockdown inhibits tumor growth and promotes apoptosis .

  • Neurodegeneration: Predicted to be a risk gene for Alzheimer’s disease due to altered expression in affected brain tissues .

  • Soft Tissue Sarcoma: Downregulated in primary tumors, correlating with metastatic recurrence .

Recombinant Production and Applications

The recombinant FRRS1 antigen (Novus Biologicals NBP1-90668PEP) is optimized for research applications:

  • Antibody Specificity Validation: Used to confirm binding in competition assays .

  • Mechanistic Studies: Enables exploration of iron-related pathways in cell lines (e.g., HEK293T) .

Key Research Findings

  • FRRS1 co-localizes with AMPA receptor subunits (GluA1/GluA2) in HEK cells but does not directly regulate their surface expression .

  • In neurons, FRRS1L (a homolog) modulates synaptic transmission by influencing AMPA receptor dynamics, though FRRS1 itself lacks this role .

Technical Considerations for Experimental Use

  • Storage: Stable at -20°C; avoid freeze-thaw cycles .

  • Concentration: ≥0.5 mg/mL in urea-containing buffer .

  • Limitations: Antibodies against native FRRS1 show inconsistent neuronal labeling, necessitating recombinant tools for precise studies .

Future Directions

Current research gaps include:

  • Structural resolution of FRRS1’s iron-binding domains.

  • Therapeutic potential in iron-deficiency disorders or cancers.

  • Interactions with other cytochrome b561 family members (e.g., CYB561, Dcytb) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FRRS1; SDFR2; SDR2; Ferric-chelate reductase 1; Stromal cell-derived receptor 2; SDR-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FRRS1
Target Protein Sequence
MAVSGFTLGTCILLLHISYVANYPNGKVTQSCHGMIPEHGHSPQSVPVHDIYVSQMTFRP GDQIEVTLSGHPFKGFLLEARNAEDLNGPPIGSFTLIDSEVSQLLTCEDIQGSAVSHRSA SKKTEIKVYWNAPSSAPNHTQFLVTVVEKYKIYWVKIPGPIISQPNAFPFTTPKATVVPL PTLPPVSHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTRDDQSVMVEMSGPSK GYLSFALSHDQWMGDDDAYLCIHEDQTVYIQPSHLTGRSHPVMDSRDTLEDMAWRLADGV MQCSFRRNITLPGVKNRFDLNTSYYIFLADGAANDGRIYKHSQQPLITYEKYDVTDSPKN IGGSHSVLLLKVHGALMFVAWMTTVSIGVLVARFFKPVWSKAFLLGEAAWFQVHRMLMFT TTVLTCIAFVMPFIYRGGWSRHAGYHPYLGCIVMTLAVLQPLLAVFRPPLHDPRRQMFNW THWSMGTAARIIAVAAMFLGMDLPGLNLPDSWKTYAMTGFVAWHVGTEVVLEVHAYRLSR KVEILDDDRIQILQSFTAVETEGHAFKKAVLAIYVCGNVTFLIIFLSAINHL
Uniprot No.

Target Background

Function
Ferric-chelate reductases catalyze the reduction of Fe(3+) to Fe(2+), a crucial step in the transport of iron from endosomes to the cytoplasm.
Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 27622

OMIM: 611578

STRING: 9606.ENSP00000287474

UniGene: Hs.454779

Protein Families
FRRS1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FRRS1L and what is its role in neuronal function?

FRRS1L (Ferric Chelate Reductase 1 Like protein) is a protein identified in proteomic studies as a component of native AMPA receptor (AMPAR) complexes in the brain. It functions as an auxiliary subunit of AMPARs, specifically as part of the outer core of AMPAR accessory proteins that directly interacts with inner-core components .

The critical importance of FRRS1L in neuronal function is evidenced by the severe neurological phenotypes observed in individuals with loss-of-function mutations, including epilepsy, choreoathetosis (involuntary movements), and severe cognitive impairments .

At the molecular level, FRRS1L regulates excitatory synaptic transmission. Single-cell knockout studies demonstrate that FRRS1L is essential for maintaining normal AMPAR expression levels at the neuronal surface and for proper AMPAR-mediated synaptic transmission in hippocampal pyramidal neurons .

How does FRRS1L interact with AMPA receptors?

FRRS1L associates with AMPARs as an auxiliary subunit and interacts with both GluA1 and GluA2 subunits, as demonstrated through co-immunoprecipitation experiments in heterologous cells . Unlike some other auxiliary proteins, FRRS1L does not form dimers or oligomers in these experimental systems .

In neurons, FRRS1L displays a specific localization pattern. Recombinant FRRS1L at the neuronal surface partially co-localizes with the GluA1 subunit and primarily localizes at non-synaptic membranes . This suggests that FRRS1L might be involved in regulating a specific subpopulation of AMPARs rather than affecting all AMPARs uniformly.

Notably, native FRRS1L in the hippocampus is localized at dynein vesicles, but not kinesin5B vesicles, suggesting a role in specific trafficking pathways for AMPARs . This distinct subcellular distribution pattern may be crucial for understanding how FRRS1L regulates AMPAR function.

What mutations in FRRS1L are associated with neurological disorders?

Several loss-of-function mutations in FRRS1L have been identified in humans with severe neurological phenotypes. These include:

  • A homozygous c.961C>T (p.Gln321*) variant that leads to the loss of a C-terminal hydrophobic motif potentially important for FRRS1L's membrane localization .

  • A homozygous c.436dup (p.Ile146Asnfs*10) variant identified in a severely affected individual .

  • Additional biallelic FRRS1L variants in individuals with similar neurological phenotypes characterized by epilepsy, choreoathetosis, and cognitive deficits .

Interestingly, analysis of the c.961C>T variant showed that while mRNA levels were comparable to controls, protein levels were markedly reduced, suggesting post-transcriptional mechanisms affecting FRRS1L abundance . These findings highlight the critical importance of proper FRRS1L expression and function for normal brain development and function.

What is the expression pattern of FRRS1L during development and in adult tissues?

FRRS1L exhibits a developmentally regulated expression pattern with predominance in the brain. In mouse embryos at embryonic day 12.5 (E12.5), FRRS1L expression is evident in the ventral forebrain, with lower levels throughout the rest of the embryo .

In adult mice, FRRS1L expression is highest in several brain regions including:

  • Cortex

  • Cerebellum

  • Hippocampus

  • Basal ganglia

This expression pattern is consistent with previous reports of robust FRRS1L expression in multiple brain regions including the striatum, thalamus, and cortex . While FRRS1L is predominantly expressed in the brain, it is also expressed at lower levels in other tissues, including fibroblasts .

The developmental expression pattern suggests FRRS1L may play a role in neuronal maturation, particularly given that AMPARs promote the formation and maturation of synapses during development .

What techniques are most effective for studying FRRS1L interactions with AMPA receptor subunits?

To effectively study FRRS1L interactions with AMPAR subunits, researchers should consider the following methodological approaches:

Co-immunoprecipitation (Co-IP)

This technique has been successfully used to demonstrate interactions between FRRS1L and both GluA1 and GluA2 subunits in heterologous cells . For optimal results:

  • Use epitope tags (HA, Flag, or Myc) on FRRS1L and AMPAR subunits

  • Include appropriate controls (immunoprecipitation with non-specific antibodies)

  • Use mild lysis conditions to preserve protein-protein interactions

  • Perform reciprocal co-IPs (immunoprecipitate with anti-FRRS1L and detect AMPAR subunits, and vice versa)

Immunofluorescence co-localization

This approach can assess the co-localization of FRRS1L with GluA1 at the neuronal surface :

  • Employ high-resolution imaging techniques

  • Quantify co-localization using appropriate software and statistical analyses

  • Include controls for background fluorescence and non-specific antibody binding

  • Consider super-resolution microscopy for detailed analysis of co-localization patterns

Functional assays following genetic manipulation

The effects of FRRS1L knockout or knockdown on AMPAR function provide indirect evidence for functional interactions:

  • Use sgRNA-based single-cell knockout of FRRS1L in neurons followed by assessment of AMPAR-mediated synaptic transmission

  • Employ siRNA-mediated knockdown in neuronal cell lines followed by patch-clamp recordings of AMPA-induced currents

  • Perform rescue experiments with sgRNA-resistant FRRS1L constructs to confirm specificity

These complementary approaches provide a comprehensive understanding of FRRS1L interactions with AMPAR subunits, including specificity, subcellular localization, and functional consequences.

How should researchers approach contradictory data regarding FRRS1L function?

When encountering contradictory data in FRRS1L research, such as the observation that overexpression does not affect synaptic transmission while knockout significantly decreases it , researchers should implement a systematic approach:

Acknowledge and explore contradictions

Rather than dismissing contradictory findings, researchers should view them as potentially valuable information that might reveal important aspects of FRRS1L function .

Consider methodological differences

Carefully document and compare:

  • Cell types used (heterologous cells vs. neurons, cell lines vs. primary cultures)

  • Experimental conditions (culture conditions, age of neurons, recording conditions)

  • Genetic manipulation approaches (overexpression, knockout, knockdown)

  • Measurement techniques (electrophysiology, imaging, biochemistry)

Develop integrative explanations

Attempt to develop explanations that can account for seemingly contradictory findings, such as:

  • Ceiling effects in overexpression studies (endogenous FRRS1L might be sufficient for maximal effect)

  • Compensatory mechanisms operating in some experimental systems but not others

  • Context-dependent functions of FRRS1L in different cell types or subcellular compartments

Design targeted follow-up experiments

Based on integrative explanations, design experiments specifically aimed at resolving contradictions:

  • Dose-response studies to determine whether FRRS1L effects are concentration-dependent

  • Time-course experiments to capture dynamic changes

  • Comparative studies in multiple experimental systems under identical conditions

  • Experiments that manipulate potential compensatory mechanisms

This systematic approach to contradictory data can transform apparent inconsistencies into deeper insights about FRRS1L function and regulation.

What approaches are recommended for analyzing FRRS1L trafficking in neurons?

Given that FRRS1L is localized at dynein vesicles but not kinesin KIF5B vesicles , the following approaches are recommended for analyzing its trafficking:

Live-cell imaging with fluorescently tagged FRRS1L

  • Use pH-sensitive fluorescent tags to distinguish surface from intracellular pools

  • Employ dual-color imaging to track FRRS1L movement relative to specific compartment markers

  • Utilize photoactivatable or photoconvertible fluorescent proteins to track specific FRRS1L pools

  • Perform quantitative analysis of trafficking parameters (velocity, directionality, processivity)

Biochemical fractionation of transport vesicles

  • Use differential centrifugation to isolate various vesicle fractions

  • Immunoprecipitate specific transport vesicles using antibodies against dynein or other markers

  • Analyze FRRS1L presence in different vesicle fractions using Western blotting

  • Identify other components of FRRS1L-containing vesicles through proteomic analysis

Manipulation of trafficking machinery

  • Express dominant-negative forms of dynein or other trafficking proteins

  • Use pharmacological inhibitors of specific trafficking pathways

  • Employ genetic approaches to knock down or knockout specific trafficking proteins

  • Assess effects on FRRS1L localization and function

Analysis of activity-dependent trafficking

  • Stimulate neurons with glutamate, AMPA, or activity-inducing protocols

  • Track changes in FRRS1L localization and trafficking in response to stimulation

  • Correlate changes in FRRS1L trafficking with changes in AMPAR function

These complementary approaches can provide comprehensive insights into FRRS1L trafficking mechanisms and their functional significance in neuronal physiology.

How does FRRS1L knockout affect AMPA receptor-mediated synaptic transmission?

FRRS1L knockout has been shown to significantly decrease AMPAR-mediated synaptic transmission in hippocampal pyramidal neurons . At the molecular level, several mechanisms contribute to this effect:

Reduced surface expression of AMPAR subunits

Single-cell knockout of FRRS1L strongly reduces the expression levels of the GluA1 subunit at the neuronal surface . This suggests FRRS1L plays a critical role in promoting or stabilizing the surface expression of AMPARs.

Decreased AMPA-induced currents

Knockdown of FRRS1L in neuronally differentiated SH-SY5Y cells significantly attenuates calcium influx and diminishes AMPA-induced inward currents . This indicates FRRS1L affects not only AMPAR abundance but also their functional properties.

Subpopulation-specific effects

The observation that overexpressed FRRS1L in hippocampal neurons only co-localizes with a portion of the AMPAR GluA1 subunit at the plasma membrane suggests FRRS1L might regulate a specific subpopulation of AMPARs .

Potential trafficking disruption

FRRS1L's localization at dynein vesicles suggests it might play a role in AMPAR trafficking. Disruption of this trafficking could contribute to the reduced surface expression observed in knockout neurons.

These findings collectively demonstrate that FRRS1L is a critical regulator of AMPAR-mediated synaptic transmission, with significant implications for understanding neurological disorders associated with FRRS1L mutations.

How can researchers design experiments to elucidate FRRS1L functional domains?

To elucidate the functional domains of FRRS1L, researchers should implement a systematic approach combining multiple experimental strategies:

Generation of domain deletion and point mutants

  • Create FRRS1L constructs with deletions of specific domains or regions

  • Introduce point mutations at conserved residues or disease-associated sites

  • Include the p.Gln321* mutant, which lacks a C-terminal hydrophobic motif important for membrane localization

  • Design mutations based on bioinformatic predictions of functional domains

Functional rescue experiments

  • Express wild-type or mutant FRRS1L constructs in neurons with FRRS1L knockout

  • Assess the ability of each construct to rescue defects in AMPAR surface expression

  • Quantify rescue efficiency to identify domains essential for specific functions

  • Use electrophysiological recordings to assess functional rescue at the synaptic level

Protein-protein interaction assays

  • Use co-immunoprecipitation to assess interactions of mutant FRRS1L with AMPAR subunits

  • Perform yeast two-hybrid or mammalian two-hybrid screens to identify interaction domains

  • Use proximity labeling approaches to identify proteins associating with specific FRRS1L domains

  • Employ FRET or BRET techniques to assess interactions in living cells

Subcellular localization studies

  • Determine localization of mutant FRRS1L constructs using immunofluorescence

  • Assess co-localization with markers of specific compartments (ER, Golgi, endosomes)

  • Evaluate trafficking of mutant constructs using time-lapse imaging

  • Investigate association of mutant constructs with dynein vesicles

This systematic mapping of functional domains will provide crucial insights into how FRRS1L structure relates to its role in regulating AMPAR function and glutamatergic neurotransmission.

What considerations are important when interpreting FRRS1L overexpression studies?

When interpreting results from FRRS1L overexpression studies, researchers should consider several important factors:

Potential ceiling effects

Overexpression of FRRS1L in hippocampal neurons does not change glutamatergic synaptic transmission, unlike the significant effects observed with knockout . This may reflect a ceiling effect, where endogenous FRRS1L is sufficient for maximal effect.

Expression levels and localization

Critical assessment parameters include:

  • The level of overexpression relative to endogenous FRRS1L

  • Whether overexpressed FRRS1L localizes correctly (at neuronal surface and non-synaptic membranes)

  • Whether overexpression affects endogenous FRRS1L expression or localization

  • If overexpressed FRRS1L associates with AMPARs and dynein vesicles like endogenous FRRS1L

Potential effects on interacting proteins

Overexpression might:

  • Sequester binding partners away from normal functions

  • Disrupt protein complex stoichiometry

  • Trigger compensatory changes in expression or function of other proteins

  • Activate stress responses or other pathways that confound result interpretation

Cell type and context dependence

Effects may vary depending on:

  • Cell type used (heterologous cells vs. neurons, different neuron types)

  • Developmental stage

  • Presence of other AMPAR complex components

  • Baseline neuronal activity or other contextual factors

Temporal dynamics

Acute versus chronic overexpression might have different effects due to:

  • Adaptive responses developing over time

  • Different roles of FRRS1L in AMPAR assembly, trafficking, and function

  • Potential feedback mechanisms regulating FRRS1L expression

  • Developmental changes in interacting protein expression

These considerations are essential for accurate interpretation of FRRS1L overexpression studies and for extracting meaningful insights about its physiological functions.

What protocols are recommended for generating recombinant FRRS1L?

For generating high-quality recombinant FRRS1L for in vitro studies, researchers should consider the following protocol recommendations:

Expression system selection

  • Mammalian cells (e.g., HEK293) are optimal for FRRS1L expression, as successfully used in interaction studies

  • Consider stable cell lines for consistent production

  • For large-scale production, suspension cultures may be more efficient

  • Avoid bacterial expression systems if post-translational modifications are important

Construct design

  • Include epitope tags (HA, Flag, Myc) for detection and purification

  • Consider signal peptides for secretion or fusion proteins for enhanced solubility

  • Include cleavable purification tags (e.g., His-tag with TEV protease site)

  • Codon-optimize the sequence for the chosen expression system

  • Consider expressing specific domains separately if the full-length protein proves difficult

Expression optimization

  • Test different transfection reagents for optimal efficiency

  • Optimize cell density, DNA concentration, and expression time

  • Consider inducible expression systems for potentially toxic proteins

  • Test expression in small-scale cultures before scaling up

  • Analyze expression by Western blotting to confirm size and integrity

Purification strategy

  • Use affinity chromatography based on the included tag (e.g., anti-HA, anti-Flag)

  • Include protease inhibitors in lysis and purification buffers

  • Use mild lysis conditions to preserve protein structure and interactions

  • Consider additional purification steps like size exclusion or ion exchange chromatography

  • Assess purity by SDS-PAGE and appropriate staining methods

Specific considerations for FRRS1L

  • Given FRRS1L's membrane association with a C-terminal hydrophobic motif , include appropriate detergents during purification

  • Consider co-expression with AMPAR subunits or other interacting proteins for stability

  • If studying disease mutations like c.961C>T (p.Gln321*), compare wild-type and mutant properties

  • Since FRRS1L does not form dimers/oligomers , gel filtration should show a single monomeric peak

These protocols will facilitate production of high-quality recombinant FRRS1L suitable for various in vitro applications including structural studies, interaction analyses, and functional assays.

What experimental models are available for studying FRRS1L function?

Several experimental models have been successfully employed to study different aspects of FRRS1L function:

Heterologous cell systems

HEK cells have been used to study:

  • FRRS1L interactions with AMPAR subunits through co-immunoprecipitation

  • Whether FRRS1L forms dimers or oligomers (it does not)

  • Effects of FRRS1L mutations on protein expression and stability

These systems provide a clean background for studying specific molecular interactions but lack the neuronal context.

Primary neuronal cultures

Cultured hippocampal neurons have been used to investigate:

  • Subcellular localization of FRRS1L and co-localization with AMPAR subunits

  • Effects of FRRS1L overexpression on glutamatergic synaptic transmission

  • Consequences of FRRS1L knockout on AMPAR surface expression and function

Primary neurons provide a more physiologically relevant context for studying FRRS1L's role in synaptic function.

Single-cell knockout approaches

sgRNA-based single-cell knockout of FRRS1L in hippocampal neurons has revealed:

  • The role of FRRS1L in regulating AMPAR-mediated synaptic transmission

  • Effects on AMPAR surface expression

  • Specificity of FRRS1L function through rescue experiments

This approach allows direct manipulation of FRRS1L in individual neurons within an otherwise normal network.

Neuronal cell lines

SH-SY5Y cells differentiated to a neuronal phenotype have been used to:

  • Study effects of FRRS1L knockdown on AMPA-mediated currents

  • Investigate calcium influx following AMPAR activation

  • Assess effects of FRRS1L on AMPAR functional properties

These provide a balance between experimental accessibility and neuronal phenotype.

Mouse models

Mice expressing a lacZ reporter under the Frrs1l promoter have been used to:

  • Study expression patterns during development

  • Map regional expression in adult brain

  • Identify tissues expressing FRRS1L

Mouse models offer the advantage of studying FRRS1L in the intact nervous system.

These diverse experimental models provide complementary approaches for investigating different aspects of FRRS1L function, from molecular interactions to effects on neuronal physiology.

How should researchers analyze contradictory data in FRRS1L studies?

When analyzing contradictory data in FRRS1L research, a structured approach based on mixed methods research principles is recommended:

Data integration frameworks

Researchers should consider multiple frameworks for integrating contradictory findings:

Analysis of contradictory findings table

Contradiction TypeAnalysis ApproachExample in FRRS1L Research
Method-based contradictionsCompare methodological details, identify systematic biasesOverexpression vs. knockout effects on synaptic transmission
Context-dependent contradictionsIdentify variables that might explain different outcomesCell-type specific effects of FRRS1L manipulation
Level-of-analysis contradictionsRelate findings at different levels (molecular, cellular, systemic)Reconciling protein interactions with functional outcomes
Temporal contradictionsConsider time-course differencesAcute vs. chronic effects of FRRS1L manipulation

Systematic documentation

For each contradiction, document:

  • The specific contradictory findings and their sources

  • Methodological differences that might explain contradictions

  • Alternative theoretical explanations

  • Proposed experiments to resolve contradictions

Quantitative approaches

Where possible, use:

This systematic approach transforms apparent contradictions into research opportunities that can ultimately lead to more nuanced and comprehensive understanding of FRRS1L function.

What statistical methods are appropriate for analyzing FRRS1L experimental data?

When analyzing experimental data related to FRRS1L, researchers should select appropriate statistical methods based on the specific experimental design and data characteristics:

For comparing FRRS1L expression across conditions

  • Use parametric tests (t-test, ANOVA) for normally distributed data

  • Apply non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) for non-normal distributions

  • Employ repeated measures designs when comparing the same samples across conditions

  • Consider mixed effects models when dealing with nested data structures (e.g., multiple neurons per culture)

For co-localization analyses

  • Calculate Pearson's or Spearman's correlation coefficients to quantify co-localization

  • Use Mander's overlap coefficient to assess proportion of overlapping signals

  • Employ statistical tests to compare co-localization under different conditions

  • Consider distance-based approaches for more sophisticated spatial analyses

For electrophysiological data

  • Use paired statistical tests when comparing responses in the same cells

  • Apply appropriate corrections for multiple comparisons

  • Consider analysis of cumulative distributions for event amplitude/frequency

  • Use bootstrapping approaches for robust confidence intervals

For analyzing knockout/knockdown efficiency

  • Create frequency tables to quantify the distribution of knockout effects

  • Calculate mean, standard deviation, and confidence intervals for knockdown efficiency

  • Use appropriate statistical tests to compare protein or mRNA levels across conditions

  • Consider power analyses to determine required sample sizes

General considerations

  • Report effect sizes in addition to p-values

  • Control for multiple comparisons using methods appropriate to the experimental design

  • Use hierarchical/mixed-effects models for nested experimental designs

  • Consider Bayesian approaches for small sample sizes or complex experimental designs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.