Recombinant Human Fetal and adult testis-expressed transcript protein (FATE1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant FATE1 is synthesized using advanced platforms:

  • Expression System: Nicotiana tabacum-derived CFPS lysate enables high-yield production without cell walls, allowing efficient post-translational modifications .

  • Purification: Strep-Tag affinity chromatography achieves >70–80% purity, validated by SDS-PAGE and size-exclusion chromatography .

  • Storage: Stable in PBS pH 7.4 with 50% glycerol at -80°C for 12 months .

Functional Roles in Cellular Processes

Recombinant FATE1 has been instrumental in elucidating mechanisms underlying apoptosis resistance and organelle dynamics:

Mitochondrial-ER Interactions

  • Localizes to mitochondria-associated ER membranes (MAM), modulating ER-mitochondria distance to reduce Ca²⁺ transfer .

  • Interacts with mitochondrial Mic60/mitofilin and ER-resident emerin (EMD) to uncouple organelles, inhibiting Ca²⁺-dependent apoptosis .

Apoptosis Regulation

  • Silencing FATE1 increases caspase-3/7 activity and sensitizes cancer cells to H₂O₂, C2-ceramide, and mitotane .

  • Collaborates with RNF183 to degrade pro-apoptotic BIK, enhancing chemoresistance .

Mitochondrial Morphology

  • Promotes mitochondrial hyperfusion via interactions with Mfn2, countering Drp1-mediated fission and apoptosis .

Cancer Prognosis

Cancer TypeAssociation with FATE1Source
Adrenocortical Carcinoma (ACC)High mRNA expression correlates with poor survival (HR = 2.88; P = 0.0083)
Colorectal CancerElevated FATE1 levels linked to reduced 5-year survival (HR = 2.53; P = 0.0007)
Non-Small Cell Lung CancerCo-expression with RNF183 predicts shorter survival (HR = 2.80; P < 0.0001)

Therapeutic Insights

  • Autoantibody Detection: Circulating anti-FATE1 antibodies in 52% of ACC patients suggest immunotherapeutic potential .

  • Drug Resistance: FATE1 overexpression reduces mitotane efficacy in ACC by 40% (P < 0.01) .

Key Research Findings

Recent studies utilizing recombinant FATE1 highlight its multifaceted roles:

  1. Mechanistic Studies:

    • FATE1’s C-terminal basic residues (aa 125–183) mediate mitochondrial targeting, while TMD anchors it to ER membranes .

    • Disruption of ER-mitochondria contacts reduces mitochondrial Ca²⁺ uptake by 60% (P < 0.001) .

  2. Functional Assays:

    • Colony formation assays show FATE1 depletion reduces cancer cell viability by 70–90% in HCT116 and A549 lines .

    • TUNEL assays confirm FATE1 expression decreases H₂O₂-induced apoptosis by 45% (P < 0.05) .

Challenges and Future Directions

  • Structural Resolution: Full-length FATE1’s atomic structure remains unresolved, limiting targeted drug design.

  • Therapeutic Targeting: Small molecules disrupting FATE1-MAM interactions could enhance chemotherapy efficacy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag is required, please inform us for prioritized development.
Synonyms
FATE1; FATE; Fetal and adult testis-expressed transcript protein; Cancer/testis antigen 43; CT43; Tumor antigen BJ-HCC-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FATE1
Target Protein Sequence
MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAG SASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDA VAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLW MNQ
Uniprot No.

Target Background

Function

FATE1 regulates endoplasmic reticulum (ER)-mitochondria coupling. It negatively regulates ER-mitochondria distance and Ca2+ transfer from the ER to mitochondria, potentially influencing apoptosis. It may also collaborate with RNF183 to control BIK protein levels, thereby modulating apoptotic signaling.

Gene References Into Functions
  1. In adrenocortical carcinoma (ACC) patients, tumor FATE1 expression inversely correlates with overall survival. Cancer cells utilize FATE1's ER-mitochondria uncoupling activity to evade apoptosis and resist chemotherapy. PMID: 27402544
  2. FATE1 is a crucial survival factor in various oncogenic contexts. It prevents the accumulation of the stress-responsive BH3-only protein, BIK (BCL-2-Interacting Killer), enabling cell viability under toxic conditions. PMID: 26567849
  3. Studies indicate that FATE gene mutations are present in only 1.4% of infertile men, with some mutations not solely causing infertility. PMID: 12811541
Database Links

HGNC: 24683

OMIM: 300450

KEGG: hsa:89885

STRING: 9606.ENSP00000359375

UniGene: Hs.301960

Subcellular Location
Mitochondrion. Mitochondrion outer membrane. Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side.
Tissue Specificity
Testis-specific in fetus (aged from 6 to 11 weeks). In adult, expressed predominantly in testis, with some expression in lung, heart, kidney, adrenal gland and whole brain. Highly expressed in certain types of cancer tissues such as hepatocellular carcino

Q&A

What is the tissue distribution pattern of FATE1?

FATE1 (Fetal and Adult Testis Expressed 1) shows a highly specific expression pattern. It is predominantly expressed in testis, with significant expression also detected in adrenal gland. Lower expression levels can be found in lung, heart, kidney, and whole brain . This restricted expression pattern in normal tissues contrasts with its overexpression in various cancer types, making it an important cancer-testis antigen (CTA) . Researchers investigating FATE1 should consider this tissue distribution when designing experiments, particularly when selecting appropriate control tissues for expression studies.

What are the key molecular characteristics of FATE1?

FATE1 is a 21-kDa protein encoded by a gene mapped to chromosome Xq28 . The protein consists of 183 amino acids and contains specific structural domains including:

  • A C-terminal domain (amino acids 125-183) that directs its mitochondrial localization

  • A predicted transmembrane segment in the C-terminal region

  • Coiled-coil domains that mediate protein-protein interactions

  • Multiple stretches of basic residues that contribute to mitochondrial targeting

FATE1 belongs to the Miff protein family and shares structural similarity with Mff (mitochondrial fission factor) in its C-terminal domain, although it lacks the N-terminal domain necessary for Drp1 interaction that is present in Mff .

What are the recommended protocols for detecting FATE1 protein expression?

Detection of FATE1 requires specific methodology due to its restricted expression pattern and subcellular localization. Based on validated approaches, researchers should consider:

Western Blot Analysis:

  • Recommended dilution: 1:500-1:1000

  • Expected molecular weight: 21 kDa

  • Positive controls: Human testis tissue, mouse testis tissue

Immunofluorescence:

  • Use paraformaldehyde fixation (typically 4%) followed by permeabilization

  • Co-staining with mitochondrial markers (TOM20, HSP60) and ER markers is recommended for localization studies

  • Confocal microscopy is preferred for precise subcellular localization analysis

Subcellular Fractionation:

  • The Wieckowski procedure is recommended for separating crude mitochondria, ER, pure mitochondria, and MAM fractions

  • FATE1 should be detectable in crude mitochondria, ER, and MAM fractions but not in pure mitochondrial fractions

How can recombinant FATE1 be optimally produced and purified?

Production of recombinant FATE1 requires careful consideration of expression systems and purification strategies:

Expression Systems:

  • Cell-free protein synthesis (CFPS) systems have been successfully used

  • HEK-293 cells expression system provides proper folding and post-translational modifications

  • Wheat germ-based systems can be used for smaller fragments

Purification Tags:

  • Strep-Tag, His-tag, and GST fusion systems have all been validated

  • One-step Strep-tag purification has been effective for CFPS-expressed FATE1

Purification Quality:

  • Expected purity: >70-80% as determined by SDS-PAGE, Western Blot, and analytical SEC (HPLC)

  • Storage recommendations: Aliquot and store at -20°C in buffer containing glycerol (typically 50%) to maintain stability

How can researchers accurately determine FATE1's subcellular localization?

FATE1's precise subcellular localization is critical for understanding its function. Methodological approaches should include:

Immunofluorescence Co-localization:

  • Co-stain with established markers including:

    • Mitochondrial markers: TOM20, HSP60

    • ER markers: SERCA2, calnexin

    • MAM markers: VDAC1, Sigma-1 receptor (S1R)

  • Calculate Pearson's correlation coefficient for quantitative assessment of co-localization

Subcellular Fractionation:

  • Use the Wieckowski method to isolate:

    • Crude mitochondria

    • ER fraction

    • Pure mitochondria

    • MAM fraction

  • Confirm fraction purity using established markers for each compartment

Electron Microscopy:

  • Immunoelectron microscopy has confirmed that FATE1 is associated with the mitochondrial surface

  • This technique can provide nanometer-scale resolution of protein localization

What methodologies are used to study FATE1's role in ER-mitochondria communication?

FATE1 functions at the interface between ER and mitochondria, regulating organelle communication. Key methodological approaches include:

ER-Mitochondria Distance Measurement:

  • Confocal microscopy with ER and mitochondrial markers

  • Electron microscopy for high-resolution analysis

  • Quantitative measurement of the distance between organelles using image analysis software

Calcium Transfer Assays:

  • Measure mitochondrial calcium uptake following ER calcium release using:

    • Genetically encoded calcium indicators targeted to mitochondria

    • Histamine stimulation to induce ER calcium release

    • Fluorescent calcium indicators (Fluo-4, Rhod-2)

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation to identify FATE1 interactors at the ER-mitochondria interface

  • Proximity ligation assays to visualize and quantify interactions in situ

  • Mass spectrometry to identify novel interaction partners

How does FATE1 mechanistically regulate mitochondrial morphology and fusion?

FATE1 has been shown to promote mitochondrial hyperfusion, a phenomenon with implications for cancer cell survival. Research methodologies should include:

Mitochondrial Morphology Assessment:

  • Live-cell imaging of mitochondrial networks using mitochondria-targeted fluorescent proteins

  • Quantitative analysis of mitochondrial parameters (length, interconnectivity, aspect ratio)

  • Time-lapse imaging to capture dynamic changes in mitochondrial morphology

Fusion Protein Interaction Studies:

  • Co-immunoprecipitation with mitochondrial fusion proteins (Mfn1, Mfn2)

  • Reconstitution experiments in Mfn1/Mfn2 knockout cells

  • Analysis suggests a specific role for Mfn2, but not Mfn1, in FATE1-mediated effects

Response to Fusion/Fission Stimuli:

  • Compare mitochondrial fragmentation in response to TNF and valinomycin between FATE1-expressing and control cells

  • Measure fusion/fission events in real-time using photoactivatable mitochondrial markers

What experimental approaches can measure FATE1's impact on cancer cell apoptosis resistance?

FATE1 contributes to cancer cell survival through multiple mechanisms. Experimental strategies include:

Apoptosis Assays:

  • Caspase-3/7 activity measurements in cells with modulated FATE1 expression

  • TUNEL assay for quantitative assessment of apoptotic cells

  • Compare responses to different apoptotic stimuli:

    • H₂O₂ and C2-ceramide (Ca²⁺-dependent apoptosis)

    • Staurosporine (Ca²⁺-independent apoptosis)

    • Chemotherapeutic agents (mitotane, paclitaxel)

Gain/Loss-of-Function Studies:

  • Doxycycline-inducible FATE1 expression systems

  • siRNA-mediated knockdown for loss-of-function studies

  • Rescue experiments with wild-type vs. mutant FATE1

Pro-apoptotic Protein Degradation:

  • Measure levels of pro-apoptotic BH3-only protein Bik in cells with modulated FATE1 expression

  • Assess protein stability and half-life through cycloheximide chase experiments

How can researchers investigate the clinical significance of FATE1 expression in cancer specimens?

Understanding the relationship between FATE1 expression and clinical outcomes requires specialized approaches:

Tissue Microarray Analysis:

  • Immunohistochemical detection of FATE1 in tumor tissues

  • Scoring systems for expression levels (low/medium/high)

  • Correlation with clinicopathological parameters

Survival Analysis:

Response to Therapy:

  • Comparison of FATE1 expression levels in treatment-responsive vs. resistant tumors

  • In vitro drug sensitivity testing with modulated FATE1 expression

  • FATE1 has been linked to resistance to mitotane in adrenocortical carcinoma and paclitaxel in non-small-cell lung cancer

What experimental approaches can determine structure-function relationships in FATE1?

Understanding which domains of FATE1 mediate specific functions is crucial for mechanistic studies:

Domain Mapping:

  • Generate a battery of FATE1 mutants with specific domain deletions or mutations

  • Key constructs to consider:

    • C-terminal domain (aa 125-183) - sufficient for mitochondrial targeting

    • N-terminal domain (aa 1-124) - shows nuclear localization

    • Basic residue mutations (RR138-139AA, RRR146-147-149AAA, RHR159-160-161AAA)

    • Coiled-coil disrupting mutations (L151D)

Structure-Function Analysis:

  • Express mutant constructs as GFP fusion proteins

  • Assess localization by fluorescence microscopy

  • Measure functional outcomes:

    • ER-mitochondria distance

    • Calcium transfer

    • Apoptosis resistance

Protein-Protein Interaction Mapping:

  • Identify which domains mediate interactions with known partners:

    • EMD (emerin)

    • Mic60/mitofilin

    • GRP75

What approaches can determine the regulation of FATE1 expression in normal and cancer cells?

Understanding FATE1 regulation provides insights into its role in cancer:

Transcriptional Regulation:

  • Promoter analysis using reporter assays

  • ChIP assays to confirm transcription factor binding

  • Steroidogenic factor-1 (SF-1) has been identified as a key regulator of FATE1 expression in adrenocortical carcinoma cells

Expression Analysis:

  • qRT-PCR for mRNA expression

  • Western blot for protein levels

  • Immunohistochemistry in tissue samples

  • Correlate expression with cellular states (proliferation, stress response)

Epigenetic Regulation:

  • DNA methylation analysis of the FATE1 promoter

  • Histone modification assessment

  • Effects of epigenetic modifiers (HDAC inhibitors, DNA methyltransferase inhibitors)

What are the critical quality control parameters for recombinant FATE1 protein production?

Ensuring high-quality recombinant FATE1 requires rigorous quality control:

Purity Assessment:

  • SDS-PAGE with Coomassie staining (expected purity >80%)

  • Western blot with anti-tag antibodies

  • Analytical size exclusion chromatography (HPLC)

Functional Validation:

  • Binding assays with known interaction partners

  • Circular dichroism to confirm proper folding

  • Activity assays based on known FATE1 functions

Storage Stability:

  • Aliquot and store at -20°C

  • Avoid repeated freeze/thaw cycles

  • Include glycerol (typically 50%) in storage buffer

  • Test stability after various storage times

Quality ParameterAcceptance CriteriaTest Method
Purity>80%SDS-PAGE, Western Blot, SEC-HPLC
IdentityPositive band at 21 kDaWestern Blot
SolubilityClear solutionVisual inspection
Endotoxin<1.0 EU/μgLAL test
Functional activityInteraction with known partnersCo-IP or binding assay

What cell lines and model systems are most appropriate for FATE1 functional studies?

Selection of appropriate experimental systems is crucial:

Cell Line Models:

  • H295R adrenocortical carcinoma cells (express FATE1 endogenously)

  • H295R/TR cell lines with doxycycline-inducible FATE1 expression

  • HeLa cells for transient transfection studies

  • Non-small-cell lung cancer cell lines (show dependence on FATE1 for chemoresistance)

Knockout/Knockdown Systems:

  • siRNA-mediated knockdown (validated sequences available)

  • CRISPR/Cas9-mediated knockout

  • Doxycycline-inducible shRNA systems

Animal Models:

  • Consider tissue-specific expression pattern when designing in vivo studies

  • Focus on cancer xenograft models with modulated FATE1 expression

  • Assess effects on tumor growth, metastasis, and therapy response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.