Recombinant Human Fibronectin type III domain-containing protein 9 (FNDC9)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Fibronectin Type III Domain-Containing Protein 9 (FNDC9)

Recombinant Human Fibronectin Type III Domain-Containing Protein 9 (FNDC9) is a protein-coding gene in humans . It is related to spinocerebellar ataxia 14 .

Basic Information

FNDC9, also known as fibronectin type III domain-containing 9, is encoded by the FNDC9 gene . The FNDC9 gene is located on chromosome 9 in humans . It encodes a protein that contains a fibronectin type III domain . These domains are typically involved in cell adhesion and extracellular matrix organization . The molecular weight of FNDC9 is approximately 25.3 kDa, and its isoelectric point (pI) is 5.65 . The amino acid sequence is 227 residues long .

FNDC9 in Research

FNDC9 is one of 29 buffalo fibronectin genes that belong to the type III domain proteins . Studies of FNDC5, another member of the fibronectin family, show it may act as a ligand of gonadal hormone receptors .

Tables

Table 1. Characteristics of Fibronectin Type III Domain Proteins

GeneChr.Exon CountMW (Da)A.ApIAIIIGRAVY
Fibronectin 1 (FN1)246258,641.5323545.2869.7440.09-0.487
Fibronectin type III domain containing 5 (FNDC5)2622,869.332056.4492.6852.30-0.218
Fibronectin type III domain containing 3B (FNDC3B)131127,736.3411605.9169.9153.98-0.434
Fibronectin type III and ankyrin repeat domains 1 (FANK1)231438,413.933458.5189.5133.76-0.334
Fibronectin type III and SPRY domain containing 1 like (FSD1L)31658,607.095216.3275.9346.15-0.574
Leucine-rich repeat and fibronectin type III domain containing 1 (LRFN1)18882,023.667707.8990.1649.73-0.066
Leucine-rich repeat and fibronectin type III domain containing 5 (LRFN5)20852,122.684666.6095.4735.44-0.141
Fibronectin type III and SPRY domain containing 1 (FSD1)91355,768.586624.9677.8848.72-0.380
Fibronectin type III domain containing 3A (FNDC3A)1331133,632.5612176.4471.2746.88-0.412
Fibronectin type III domain containing 1 (FNDC1)1023205,865.7819059.6659.0159.92-0.799
Leucine-rich repeat and fibronectin type III domain containing 3 (LRFN3)18572,450.766799.3887.0559.78-0.246
Fibronectin type III and SPRY domain containing 2 (FSD2)201584,755.737474.8169.6947.20-0.593
Fibronectin type III domain containing 7 (FNDC7)61385,949.118116.5377.6945.180.046
Ankyrin repeat and fibronectin type III domain containing 1 (ANKFN1)320120,567.7910686.5280.7358.15-0.467
Immunoglobulin like and fibronectin type III domain containing 1 (IGFN1)526347,525.9934906.4955.3534.98-0.590
Fibronectin type III domain containing 4 (FNDC4)12724,753.162307.6688.8755.08-0.252
Fibronectin type III domain containing 8 (FNDC8)3434,298.933125.2980.9346.44-0.370
Leucine-rich repeat and fibronectin type III domain containing 4 (LRFN4)5366,839.106366.7094.1442.55-0.028
Fibronectin type III domain containing protein 3C1-like (LOC102393884)X27157,320.5414336.7971.8445.92-0.439
Fibronectin leucine-rich transmembrane protein 2 (FLRT2)11473,773.406607.8994.1836.58-0.185
EGF like, fibronectin type III and laminin G domains (EGFLAM)1923112,751.5410326.5374.4641.70-0.325
Fibronectin type III domain containing 9 (FNDC9)9225,342.982275.6585.9954.56-0.055
Leucine-rich repeat and fibronectin type III domain containing 2 (LRFN2)2287,694.088206.5990.8844.73-0.097
Fibronectin leucine-rich transmembrane protein 3 (FLRT3)14373,171.756497.5694.1844.53-0.296
Fibronectin leucine-rich transmembrane protein 1 (FLRT1)5274,144.686776.1596.8832.12-0.122
Fibronectin type III domain containing 11 (FNDC11)14438,198.373336.8196.3453.23-0.280
Fibronectin type III domain containing 10 (FNDC10)5324,097.322259.1187.3366.150.124
Extracellular leucine-rich repeat and fibronectin type III domain containing 2 (ELFN2)4490,363.678247.7881.7848.76-0.295
Extracellular leucine-rich repeat and fibronectin type III domain containing 1 (ELFN1)24387,687.608088.8279.4361.89-0.351
  • Chr. = Chromosome

  • MW = Molecular Weight

  • A.A = Amino Acid

  • pI = Isoelectric Point

  • AI = Aliphatic Index

  • II = Instability Index

  • GRAVY = Grand Average of Hydropathy

Table 2. Molecular Docking Results of Ligand (FNDC5 or Irisin) Binding Affinity with Different Receptors

Sr. No.ReceptorDocking ScoreLigand RMSD (A0)Ligand Interacting Residues
1Androgen-311.4086.42Asn36, Thr38, Arg40
2DDB1 and CUL4 associated factor 6-256.6379.76Asn36, Thr38, Arg40, His41
3Estrogen-related receptor β-295.57108.96Arg72, Mse73, Leu74, Arg75, Phe76, Ile77, Gln78, Glu79, Val80, Asn81, Cys87, Ala88, Trp90, Asp91
4Estrogen-related receptor γ-256.6379.76Arg40, His41, Lys43, Lys120, Pro122, Arg123
5Krüppel-like factor 15-260.7181.85Ser30, Pro31, Arg72, Mse73, Leu74, Arg75, Phe76, Ile77, Gln78, Glu79, Asn81, Ala88, Trp90, Gln108, Pro112, Val180
6Nuclear receptor subfamily 3 group C member 1-308.59108.34Lys740, Glu741, Asn742, Leu744, Leu745, Arg746, Leu748, Leu749, Asp753

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FNDC9; C5orf40; Fibronectin type III domain-containing protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FNDC9
Target Protein Sequence
MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHHEEKVPRTISS VVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAIL LACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPL VEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE
Uniprot No.

Target Background

Database Links

HGNC: 33547

KEGG: hsa:408263

UniGene: Hs.437066

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Fibronectin Type III Domain-Containing Protein 9 (FNDC9)?

FNDC9 belongs to the fibronectin type III domain-containing protein family, which includes transmembrane proteins that may act as receptors for fibronectin. The FNDC family consists of 11 members (FNDC1, FNDC3A, FNDC3B, FNDC4, FNDC5, FNDC6, FNDC7, FNDC8, FNDC9, FNDC10, and FNDC11) with diverse functions in regulating signal transduction and cellular pathways . FNDC9 specifically contains fibronectin type III domains, which are approximately 90 amino acids long and composed of seven β-strands forming two antiparallel β-sheets, similar to other members of this protein family .

What are the primary research models used for studying FNDC9?

Research on FNDC9 has been conducted in various model organisms, particularly:

SpeciesGene IDProtein AccessionNotes
Mouse (Mus musculus)MGI:2443410-Knockout models available with phenotypic data
American crow (Corvus brachyrhynchos)103611435XP_008627178.1Genomic annotation available
Platypus (Ornithorhynchus anatinus)103164706Multiple isoforms (XP_028907995.1, XP_028907994.1, XP_007653516.1, XP_028907996.1)Multiple transcript variants identified

Researchers typically use recombinant protein expression systems (commonly E. coli) to produce FNDC9 for functional studies, similar to methods used for other fibronectin domains .

What are the optimal expression systems for producing recombinant human FNDC9?

For recombinant expression of FNDC9, researchers typically employ bacterial expression systems similar to those used for other fibronectin domains. Based on protocols for related proteins:

  • E. coli expression system: The full-length FNDC9 gene can be synthesized with codon optimization and expressed with a small tag (such as T7-His-TEV cleavage site) fusion at its N-terminal .

  • Expression optimization: When expressed in E. coli, fibronectin domains often form inclusion bodies. Specialized refolding techniques such as "temperature shift inclusion body refolding" technology followed by chromatographic purification can be employed to obtain functional protein .

  • Mammalian expression systems: For studies requiring post-translational modifications, mammalian expression systems using vectors such as pcDNA3.1 may be more appropriate, especially when studying interaction with other human proteins .

The choice of expression system should be determined by the specific research question, with bacterial systems offering higher yield but mammalian systems potentially providing more physiologically relevant modifications.

How can researchers verify the functional activity of recombinant FNDC9?

Verifying functional activity of recombinant FNDC9 requires multiple complementary approaches:

  • Cell adhesion assays: Since fibronectin domains are involved in cell adhesion, quantitative adhesion assays can determine if the recombinant protein maintains this function. Typically, 4 × 10^4 cells/well are added to plates coated with the recombinant protein (1 μg/mL, 100 μL/well) and adhesion is measured after 30-60 minutes at 37°C .

  • Protein binding studies: Surface plasmon resonance (SPR) can determine binding affinities to potential interacting partners. For fibronectin domains, this typically includes integrins and other extracellular matrix components .

  • Structural integrity assessment: Circular dichroism (CD) spectroscopy can confirm proper folding of the β-sheet structure characteristic of fibronectin type III domains .

  • Functional complementation: Testing whether the recombinant FNDC9 can rescue phenotypes in cellular models where endogenous FNDC9 has been knocked down.

What are the appropriate storage conditions for maintaining FNDC9 stability?

Based on protocols for related fibronectin domain proteins, researchers should:

  • Store lyophilized FNDC9 at -20°C to -80°C.

  • For reconstituted protein, store at 1.0 mg/mL in sterile-filtered buffer (typically 20 mM pH 8.0 Tris-HCl) with appropriate additives (NaCl, KCl, EDTA, arginine, DTT, and glycerol) .

  • For long-term storage, keep at -80°C; the protein remains stable at 4°C for at least 15 days .

  • Avoid repeated freeze-thaw cycles by preparing small aliquots before freezing.

What techniques are most effective for detecting tissue-specific expression of FNDC9?

To comprehensively analyze FNDC9 tissue expression patterns:

  • mRNA detection:

    • qRT-PCR with appropriate reference genes for relative quantification

    • RNA in situ hybridization for spatial localization within tissues

    • RNA-seq for genome-wide expression analysis and identification of co-expressed genes

  • Protein detection:

    • Immunohistochemistry using validated antibodies against FNDC9

    • Western blotting for semi-quantitative protein expression analysis

    • Mass spectrometry-based proteomics for unbiased detection and quantification

  • Single-cell analysis for cell-type specific expression:

    • Single-cell RNA-seq to identify specific cell populations expressing FNDC9

    • Fluorescence-activated cell sorting (FACS) with antibody staining

What phenotypes are associated with FNDC9 knockout/knockdown models?

Mouse FNDC9 knockout models (Fndc9 tm1.1(KOMP)Vlcg/Fndc9 tm1.1(KOMP)Vlcg) demonstrate multiple phenotypes, suggesting diverse physiological roles:

Phenotypic CategoryObserved Phenotypes
Metabolic- Decreased lean body mass
- Increased total body fat amount
- Increased circulating alkaline phosphatase level
- Increased circulating bilirubin level
Hematological- Decreased lymphocyte cell number
- Increased neutrophil cell number
- Increased mean platelet volume
Musculoskeletal- Decreased bone mineral content
- Decreased grip strength
Reproductive- Female infertility
- Male infertility
Behavioral- Decreased thigmotaxis
- Hyperactivity

These diverse phenotypes indicate FNDC9 plays important roles in metabolism, immune function, bone development, reproductive biology, and potentially neurological function .

How do structural variations in FNDC9 impact its function in different cellular contexts?

Investigating structure-function relationships in FNDC9 requires sophisticated approaches:

  • Site-directed mutagenesis: Create systematic mutations in FNDC9, particularly at conserved residues, to identify critical amino acids for function. Monitor effects on protein folding, stability, and binding to partner molecules.

  • Domain swapping experiments: Exchange domains between FNDC9 and related proteins to determine which regions are responsible for specific functions.

  • Structural biology techniques:

    • X-ray crystallography to determine high-resolution structure

    • Cryo-electron microscopy for visualization of larger complexes

    • NMR spectroscopy to study dynamic aspects of protein structure

  • Molecular dynamics simulations: Predict how mutations or post-translational modifications might alter protein dynamics and function.

  • Cell-specific functional assays: Test mutant proteins in appropriate cellular contexts reflecting different tissues where FNDC9 is expressed, as function may be context-dependent.

What role does FNDC9 play in cellular signaling cascades?

To elucidate FNDC9's role in signaling:

  • Phosphoproteomic analysis: Compare phosphorylation patterns in cells with and without FNDC9 to identify affected signaling pathways.

  • Transcriptomic profiling: RNA-seq analysis after FNDC9 overexpression or knockdown can reveal downstream gene expression changes.

  • Reporter assays: Use pathway-specific reporters (e.g., for MAPK, Wnt, or TGF-β pathways) to determine which signaling cascades are modulated by FNDC9.

  • Live-cell imaging: Use fluorescent biosensors to visualize signaling events in real-time following FNDC9 engagement.

  • Interactome mapping: Identify FNDC9-interacting proteins that participate in signaling cascades using proximity labeling approaches such as BioID or APEX.

How might post-translational modifications affect FNDC9 function?

Post-translational modifications (PTMs) likely regulate FNDC9 function. To investigate:

  • PTM identification:

    • Mass spectrometry to identify glycosylation, phosphorylation, and other modifications

    • Western blotting with modification-specific antibodies

    • Enrichment strategies to isolate modified forms of FNDC9

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Comparison of protein expressed in systems with different PTM capabilities

    • Activity assays comparing modified and unmodified forms of the protein

  • Regulation of modifications:

    • Identify enzymes responsible for adding/removing PTMs

    • Determine stimuli that trigger changes in modification status

    • Assess PTM patterns across different tissues and developmental stages

What are the emerging technologies that could advance FNDC9 research?

Several cutting-edge technologies hold promise for FNDC9 research:

  • CRISPR-based approaches:

    • Base editing for introducing precise mutations

    • CRISPRi/CRISPRa for modulating endogenous expression

    • CRISPR screens to identify genetic interactions

  • Spatial transcriptomics to map FNDC9 expression within complex tissues with subcellular resolution.

  • Organoid models to study FNDC9 function in physiologically relevant 3D tissue contexts.

  • AlphaFold and other AI-based structure prediction tools to model FNDC9 structure and interactions when experimental structures are unavailable.

  • Single-molecule imaging techniques to visualize FNDC9 dynamics and interactions in living cells.

How can inconsistencies in FNDC9 research results be reconciled?

When facing contradictory findings in FNDC9 research:

  • Consider experimental context differences:

    • Cell types or tissues used (expression of co-factors may vary)

    • Species differences (human vs. mouse FNDC9 may have distinct functions)

    • In vitro vs. in vivo studies (environmental factors may be significant)

  • Evaluate methodological factors:

    • Antibody specificity issues in detection methods

    • Recombinant protein production systems affecting structure/function

    • Knockout/knockdown efficiency and specificity

  • Analyze protein isoforms: Different splice variants may have distinct functions, as suggested by the multiple isoforms identified in some species .

  • Coordinate collaborative studies: Establish standardized protocols across laboratories to validate key findings and resolve discrepancies.

FNDC9 Orthologs Across Species

SpeciesGene IDProtein AccessionSimilarity to Human FNDC9Reference
Human (Homo sapiens)--100% (reference)-
Mouse (Mus musculus)MGI:2443410-High (phenotype data available)
American crow (Corvus brachyrhynchos)103611435XP_008627178.1Moderate
Platypus (Ornithorhynchus anatinus)103164706Multiple isoformsModerate

Phenotypes Associated with FNDC9 Deficiency in Mouse Models

SystemPhenotypePotential Research ApplicationsReference
MetabolicDecreased lean body massObesity, metabolic disorders
MetabolicIncreased total body fatAdipose tissue regulation
MetabolicIncreased alkaline phosphataseLiver function, bone metabolism
MetabolicIncreased bilirubinLiver function
HematologicalAltered blood cell countsImmune function, inflammation
MusculoskeletalDecreased bone mineral contentOsteoporosis, bone development
ReproductiveInfertility (both sexes)Reproductive biology
Neurological/BehavioralHyperactivity, decreased thigmotaxisBehavioral disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.