Recombinant Human Frizzled-10 (FZD10)

Shipped with Ice Packs
In Stock

Description

Wnt Signaling Studies

Recombinant FZD10 is used to dissect canonical (β-catenin-dependent) and non-canonical Wnt pathways:

  • Binds WNT7A/7B and partners with LRP5/6 to stabilize β-catenin .

  • The linker domain between CRD and transmembrane regions influences Wnt specificity and downstream signaling .

Cancer Research

FZD10 is overexpressed in cancers like colorectal carcinoma and synovial sarcoma but absent in healthy tissues :

  • Colon Cancer: Cytoplasmic FZD10 levels increase with tumor stage, while nuclear expression declines .

  • Synovial Sarcoma: Targeted in clinical trials (e.g., NCT01469975) using radiolabeled anti-FZD10 antibodies (¹¹¹In/⁹⁰Y-OTSA101) .

Developmental Biology

During embryogenesis, FZD10 localizes to neural tubes, limb buds, and airway epithelia, often colocalizing with Sonic Hedgehog (Shh) .

Diagnostic Potential

  • Nuclear FZD10 expression inversely correlates with tumor malignancy in colon cancer, suggesting prognostic utility .

  • Table: FZD10 Expression in Cancer Types

Cancer TypeCytoplasmic TrendNuclear TrendClinical Implication
Colon↑ with stage↓ in T3/T4 and metastasesMarker for advanced staging
Melanoma/Gastric↓ with stageModerate ↓ in metastasesLimited diagnostic utility

Therapeutic Targeting

  • Radioimmunotherapy: Phase I trials (SYNFRIZZ) using ⁹⁰Y-OTSA101 showed stable disease in 5/8 synovial sarcoma patients but no objective responses .

  • Small-Molecule Inhibitors: Research focuses on disrupting FZD10-Wnt interactions to block oncogenic signaling .

Challenges and Future Directions

  • Heterogeneous Tumor Uptake: Limits efficacy in radioimmunotherapy .

  • Pathway Complexity: Crosstalk between canonical/non-canonical pathways complicates therapeutic targeting .

Future studies aim to optimize FZD10-targeted therapies and explore its role in tumor microenvironment regulation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your desired format in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize its inclusion in the production process.
Synonyms
FZD10; Frizzled-10; Fz-10; hFz10; FzE7; CD antigen CD350
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-581
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCH GHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNK NDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHH VEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPE RPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFG MASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDEL TGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKL MVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASIPA VEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKA QHPQKTHHGKYEIPAQSPTCV
Uniprot No.

Target Background

Function
Frizzled-10 (FZD10) is a receptor for Wnt proteins. It plays a crucial role in the canonical Wnt/beta-catenin signaling pathway. This pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and the activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it remains unclear if it represents a distinct pathway or if it integrates into the canonical pathway. PKC appears to be necessary for Wnt-mediated inactivation of GSK-3 kinase. Both pathways appear to involve interactions with G-proteins. FZD10 may participate in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable).
Gene References Into Functions
  1. There was a strong inverse correlation between nuclear immunostaining scores for beta-catenin expression and expression patterns of FZD10 PMID: 19134005
  2. FZD10 transactivation causes the activation of the Dvl-Rac1-JNK pathway and is associated with the development/progression of synovial sarcomas PMID: 19137009
Database Links

HGNC: 4039

OMIM: 606147

KEGG: hsa:11211

STRING: 9606.ENSP00000229030

UniGene: Hs.31664

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highest levels in the placenta and fetal kidney, followed by fetal lung and brain. In adult brain, abundantly expressed in the cerebellum, followed by cerebral cortex, medulla and spinal cord; very low levels in total brain, frontal lobe, temporal lobe an

Q&A

What is Frizzled-10 and what is its role in cellular signaling?

Frizzled-10 (FZD10), also known as CD350, is a 68 kDa seven-pass transmembrane glycoprotein belonging to the Frizzled family of Wnt receptors. It features a 205 amino acid N-terminal extracellular region containing a cysteine-rich domain that serves as the Wnt binding domain and mediates receptor oligomerization. The C-terminal cytoplasmic tail contains a PDZ-interaction motif that mediates intracellular binding to scaffolding proteins .

FZD10 primarily functions as a receptor in the Wnt signaling pathway. It associates with LRP5 to transduce Wnt-7a and Wnt-7b signals, resulting in the stabilization of cytoplasmic beta-catenin. This activity plays crucial roles in embryonic development, tissue homeostasis, and is implicated in certain pathological conditions including cancer .

How does recombinant FZD10 differ from native FZD10?

Recombinant FZD10 proteins are engineered versions designed for research applications. Commercial recombinant human FZD10 typically contains the extracellular domain (ECD) of human FZD10 fused to an Fc tag or other fusion partners. For example, commercially available recombinant human FZD10 often includes amino acids Ile21-Gly161 (the cysteine-rich domain) fused to human IgG1 Fc region .

While native FZD10 is a membrane-bound receptor with seven transmembrane domains, recombinant versions typically contain only the extracellular domain that maintains Wnt-binding capabilities. This design facilitates protein purification and experimental applications while preserving the functional binding properties necessary for most research purposes. The recombinant protein lacks the transmembrane and intracellular domains, which affects its cellular localization and some downstream signaling capabilities.

What is the expression pattern of FZD10 during embryonic development?

FZD10 exhibits dynamic and region-specific expression during embryonic development. It is expressed in:

  • The primitive streak during early embryogenesis

  • The dorsal neural tube

  • The developing brain, particularly in the dorsal telencephalon

  • Limb buds

  • Airway epithelium

In the developing nervous system, FZD10 is induced by Sonic hedgehog (Shh) and colocalizes with Shh and Wnt-7a in the neural tube . Transgenic mouse studies using FZD10 promoter-driven reporters have demonstrated strong expression in the developing cortex and hippocampus, as well as in the dorsal thalamus and dorsal neural tube . This regionalized expression pattern suggests specific roles for FZD10 in the development of these structures.

What are the primary tissue expression sites of FZD10 in adult organisms?

In adult tissues, FZD10 expression is more restricted compared to its embryonic distribution. Primary expression sites include:

  • Placenta

  • Gastric glands

  • Colon epithelial cells

  • Renal tubule epithelial cells

In the adult brain, FZD10 expression is particularly pronounced in the pyramidal cell fields of the hippocampus, as demonstrated by transgenic mouse models . This specific expression pattern suggests ongoing roles for FZD10 in adult neuronal function and potentially in tissue homeostasis of specific epithelial structures.

How does carrier-free recombinant FZD10 differ from versions with carrier proteins?

Carrier-free (CF) recombinant FZD10 lacks bovine serum albumin (BSA) or other carrier proteins that are typically added to enhance stability. The differences are:

CharacteristicCarrier-Free FZD10FZD10 with Carrier Protein
CompositionPure recombinant proteinRecombinant protein + BSA
StabilityPotentially less stableEnhanced stability
Shelf-lifeMay be shorterTypically longer
Storage concentrationMust be stored at higher concentrationCan be stored at more dilute concentration
Application suitabilityBest for applications where BSA would interfereRecommended for cell/tissue culture, ELISA standards
ReconstitutionTypically at 100 μg/mL in sterile PBSOften at lower concentrations

Carrier-free FZD10 is particularly recommended for applications where the presence of BSA could interfere with experimental outcomes, while versions with carrier proteins are more suitable for general cell culture applications and as ELISA standards .

How can recombinant FZD10 be used to study Wnt signaling specificity?

Recombinant FZD10 provides a valuable tool for dissecting the specificity of Wnt-Frizzled interactions. Methodological approaches include:

  • Binding assays: Recombinant FZD10-Fc chimeras can be used in surface plasmon resonance (SPR) or similar binding assays to determine binding affinities with different Wnt ligands. This helps establish which Wnt proteins preferentially interact with FZD10.

  • Competitive binding studies: By using recombinant FZD10 proteins in conjunction with cell-based assays, researchers can determine if FZD10 specifically competes for certain Wnt ligands, helping map the Wnt-Frizzled interaction landscape.

  • Pathway activation studies: Recombinant FZD10 can be used in reporter gene assays measuring β-catenin-dependent transcription to determine which Wnt ligands activate canonical signaling through FZD10.

Research has demonstrated that FZD10 associates with LRP5 to specifically transduce Wnt-7a and Wnt-7b signals, leading to cytoplasmic β-catenin stabilization . This specificity is important, as FZD10 appears to be required for Wnt1-dependent but not Wnt3a-dependent signaling in neural development contexts .

What are effective methods for studying FZD10 knockdown effects in developmental models?

Effective approaches for studying FZD10 knockdown include:

  • shRNA-mediated knockdown: Short hairpin RNA (shRNA) targeting FZD10 can be delivered via electroporation into developing tissues like the neural tube. This approach has successfully demonstrated FZD10's role in neural proliferation and patterning .

  • CRISPR/Cas9 genome editing: For more permanent and potentially complete loss of function, CRISPR/Cas9 can be used to generate targeted mutations in the FZD10 gene.

  • Morpholino oligonucleotides: In zebrafish or Xenopus models, morpholinos can provide transient knockdown to study early developmental roles.

  • Conditional knockout using Cre-loxP: The FZD10-Cre transgenic mouse line can be crossed with floxed target genes to study downstream effectors of FZD10 signaling in specific tissues .

Research using shRNA against FZD10 in chick neural tubes has revealed that FZD10 knockdown results in reduced cell proliferation (as measured by phospho-histone H3 staining) and altered dorso-ventral patterning with dorsal restriction of Pax6 and Pax7 expression domains .

How can recombinant FZD10 be used to investigate cross-talk between Wnt and other signaling pathways?

Methodological approaches for investigating signaling cross-talk include:

  • Co-immunoprecipitation studies: Recombinant FZD10 can be used to identify binding partners from cell lysates, potentially revealing interactions with components of other signaling pathways.

  • Pathway inhibitor combinations: Combining recombinant FZD10 treatments with inhibitors of related pathways (e.g., Hedgehog, Notch, BMP) can reveal synergistic or antagonistic relationships.

  • Transcriptomic analyses: RNA-seq or microarray studies following recombinant FZD10 treatment with or without other pathway modulators can reveal pathway integration at the transcriptional level.

Studies have shown that FZD10 is induced by Sonic hedgehog (Shh) and colocalizes with Shh in the neural tube, suggesting important cross-talk between these pathways . In neural development, FZD10 mediates Wnt1 signaling specifically, indicating that different Wnt ligands may engage distinct downstream pathways even within the same tissue context .

What role does FZD10 play in neural tube patterning and how can this be experimentally modeled?

FZD10 plays a crucial role in neural tube patterning through its participation in Wnt signaling. Experimental approaches to study this include:

  • In vivo electroporation: By electroporating expression vectors or shRNA constructs targeting FZD10 into one side of the developing neural tube, researchers can compare effects with the contralateral control side in the same embryo .

  • Rescue experiments: Co-electroporation of shRNA-resistant FZD10 expression constructs along with FZD10 shRNA can confirm specificity of observed phenotypes.

  • Wnt ligand overexpression: Combining Wnt1 or other Wnt ligand overexpression with FZD10 manipulation helps determine which Wnts signal through FZD10 in this context.

Research has shown that FZD10 knockdown in the neural tube results in:

  • Reduced proliferation of neural progenitors

  • Altered dorso-ventral patterning with dorsal restriction of Pax6 and Pax7 expression domains

  • Inhibition of Wnt1-induced (but not Wnt3a-induced) ventral expansion of dorsal neural markers

These findings indicate that FZD10 specifically mediates Wnt1 signaling in neural tube patterning, highlighting the ligand specificity of Frizzled receptors.

What approaches can be used to study potential therapeutic targeting of FZD10 in cancer models?

FZD10 is upregulated in certain cancers and transformed cell lines, making it a potential therapeutic target . Research approaches include:

  • Neutralizing antibodies: Developing antibodies against the extracellular domain of FZD10 that can block Wnt binding and downstream signaling.

  • Decoy receptors: Using recombinant FZD10-Fc chimeras as decoys to sequester Wnt ligands and prevent signaling through endogenous FZD10.

  • Small molecule inhibitors: Screening for compounds that disrupt FZD10-Wnt interactions or FZD10-LRP5/6 complex formation.

  • Gene silencing approaches: Using siRNA, shRNA, or CRISPR-based approaches to downregulate FZD10 expression in cancer models.

FZD10 has been shown to bind hypoxia inducible gene 2, which promotes oncogenic Wnt signaling and functions as an autocrine growth factor for renal cell carcinomas . Targeting this interaction could provide therapeutic opportunities in cancers where FZD10 is upregulated.

What are the optimal reconstitution and storage conditions for recombinant human FZD10?

For optimal handling of recombinant FZD10:

ParameterRecommended ConditionNotes
ReconstitutionReconstitute at 100 μg/mL in sterile PBSFor carrier-free versions
Storage temperature-20°C to -80°CUse manual defrost freezer
Freeze-thaw cyclesAvoid repeated cyclesAliquot before freezing
Working solution storage2-8°C for short term (1-2 weeks)
Shipping conditionTypically at ambient temperatureStore immediately upon receipt

Upon receipt, the lyophilized protein should be reconstituted and stored according to manufacturer recommendations. For carrier-free FZD10, which is typically lyophilized from a 0.2 μm filtered solution in PBS, reconstitution at 100 μg/mL in sterile PBS is recommended . To maintain protein integrity, it's crucial to avoid repeated freeze-thaw cycles by preparing single-use aliquots before freezing.

What are the most reliable assays for measuring FZD10-Wnt binding interactions?

Several methodologies can reliably assess FZD10-Wnt binding:

  • Surface Plasmon Resonance (SPR): Immobilize recombinant FZD10-Fc on a sensor chip and flow Wnt proteins over the surface to measure real-time binding kinetics and calculate dissociation constants (Kd).

  • AlphaLISA or HTRF assays: These homogeneous, bead-based proximity assays can detect interactions between labeled FZD10 and Wnt proteins in solution.

  • Pull-down assays: Immobilize FZD10-Fc on protein A/G beads and incubate with purified Wnt proteins or cell lysates containing Wnt proteins, then analyze bound proteins by Western blot.

  • Bio-Layer Interferometry (BLI): Similar to SPR but using optical interference patterns to measure binding between immobilized FZD10 and Wnt proteins.

  • Cellular reporter assays: While not direct binding assays, TOP/FOP reporter systems can indirectly measure functional FZD10-Wnt interactions through downstream β-catenin-dependent transcriptional activation.

Research has shown FZD10 specifically interacts with Wnt1 but not Wnt3a in neural patterning contexts, highlighting the importance of determining ligand specificity .

How can transgenic FZD10-Cre mouse lines be effectively utilized for conditional gene manipulation?

The FZD10-Cre transgenic mouse line provides a valuable tool for conditional gene manipulation specifically in FZD10-expressing tissues. Methodological considerations include:

  • Crossing strategy: FZD10-Cre mice should be crossed with mice carrying floxed alleles of genes of interest. Double transgenic offspring will have the target gene deleted specifically in FZD10-expressing cells.

  • Verification of recombination efficiency: Prior to phenotypic analysis, cross FZD10-Cre mice with reporter lines like ROSA26 to confirm the spatial and temporal pattern of Cre activity.

  • Developmental timing: Since FZD10 expression changes during development, the timing of Cre-mediated recombination should be carefully characterized using reporter lines at different developmental stages.

  • Background strain considerations: Maintain the line on a defined genetic background to reduce phenotypic variability.

Studies have shown that the FZD10-Cre transgenic line exhibits high recombination efficiency when crossed with the ROSA26 reporter line. Cre activity is mainly detected in the dorsal telencephalon during development and is confined to the pyramidal cell fields in the adult hippocampus . This makes the line particularly useful for studying cortical and hippocampal development and for conditional inactivation of target genes in these regions.

What controls should be included when performing FZD10 knockdown experiments?

Robust FZD10 knockdown experiments require several controls:

  • Scrambled shRNA/siRNA: Non-targeting sequences with similar nucleotide composition to rule out non-specific effects of the RNA delivery method.

  • Rescue controls: Co-expression of shRNA-resistant FZD10 should reverse the knockdown phenotype if it's specific.

  • Multiple targeting sequences: Using several independent shRNA/siRNA sequences targeting different regions of FZD10 mRNA helps confirm phenotype specificity.

  • Quantification of knockdown efficiency: qRT-PCR and/or Western blotting to confirm reduction of FZD10 expression levels.

  • Contralateral controls: In neural tube electroporation experiments, the unelectroporated side serves as an internal control for comparing gene expression patterns and cell proliferation.

Research has demonstrated the importance of these controls. For example, scrambled shRNA plasmids showed no effect on neural tube development or Pax6/Pax7 expression patterns, confirming that observed effects with FZD10 shRNA were specific to FZD10 knockdown .

What methods can determine if FZD10 signals through canonical or non-canonical Wnt pathways?

Distinguishing between canonical and non-canonical Wnt signaling downstream of FZD10 requires specific methodological approaches:

  • β-catenin stabilization assays: Western blotting for cytosolic and nuclear β-catenin following Wnt stimulation in the presence or absence of FZD10.

  • TCF/LEF reporter assays: TOP/FOP flash luciferase reporters measure β-catenin-dependent transcriptional activation, indicating canonical pathway activation.

  • Calcium imaging: Measuring intracellular calcium flux using indicators like Fluo-4 can detect activation of the Wnt/Ca²⁺ non-canonical pathway.

  • JNK phosphorylation: Assessing c-Jun N-terminal kinase activation by phospho-specific antibodies can indicate PCP pathway activation.

  • Cytoskeletal rearrangement assays: Examining changes in cell shape and actin cytoskeleton organization can indicate activation of non-canonical pathways.

  • Dishevelled phosphorylation patterns: Different phosphorylation patterns of Dvl can distinguish between canonical and non-canonical pathway activation.

How should researchers interpret contradictory findings about FZD10 function across different model systems?

When facing contradictory findings about FZD10 across different models, researchers should consider:

  • Species-specific differences: Despite high conservation (human FZD10 shares 96%, 94%, 90%, and 82% amino acid sequence identity with chick, mouse, Xenopus, and zebrafish FZD10, respectively) , subtle differences may affect function.

  • Developmental context: FZD10 expression and function changes during development, so contradictions might reflect different developmental stages rather than true discrepancies.

  • Cell type specificity: FZD10 may interact with different co-receptors and downstream effectors depending on the cellular context.

  • Experimental approach differences: Knockout versus knockdown, acute versus chronic manipulation, and in vitro versus in vivo studies may all yield different results.

  • Redundancy with other Frizzled receptors: Within the cysteine-rich domain, human FZD10 shares 71% amino acid sequence identity with FZD9 and 31%-46% with FZD1-8 , potentially allowing functional compensation in some contexts.

A systematic approach to reconciling contradictions involves directly comparing experimental conditions, confirming findings with multiple methodologies, and considering context-dependent roles for FZD10.

What are the most common technical challenges when working with recombinant FZD10 proteins?

Common technical challenges with recombinant FZD10 include:

  • Protein stability issues: The cysteine-rich domain is sensitive to redox conditions and may form inappropriate disulfide bonds, affecting functionality.

  • Aggregation problems: Recombinant Frizzled proteins can aggregate in solution, reducing activity. This is why carrier proteins like BSA are often added .

  • Hydrophobic regions: Parts of the extracellular domain may have hydrophobic patches that can cause non-specific interactions.

  • Post-translational modification differences: Recombinant FZD10 produced in different expression systems may have different glycosylation patterns than native protein.

  • Wnt ligand availability: Purified, active Wnt proteins for binding studies are notoriously difficult to produce due to their hydrophobicity and post-translational modifications.

To address these challenges, researchers should:

  • Consider multiple expression systems (mammalian vs. insect)

  • Use cryoprotectants and carrier proteins where appropriate

  • Validate protein activity with functional assays

  • Store as single-use aliquots to avoid freeze-thaw cycles

  • Add detergents or carrier proteins to prevent non-specific binding

How can researchers account for FZD10 redundancy with other Frizzled family members?

Addressing FZD10 functional redundancy requires methodical approaches:

  • Expression profiling: Characterize the complete Frizzled receptor expression pattern in the tissue of interest to identify potential redundant receptors.

  • Multiple knockdown/knockout strategies:

    • Single FZD10 knockdown

    • Combined knockdown of multiple Frizzled receptors

    • Generation of conditional compound mutants

  • Domain swap experiments: Create chimeric receptors with domains from different Frizzled family members to identify which regions confer specificity.

  • Ligand specificity analysis: Test binding and signaling responses to different Wnt ligands, as different Frizzled receptors may have overlapping but distinct ligand preferences.

  • Rescue experiments: Determine if overexpression of other Frizzled family members can rescue FZD10 loss-of-function phenotypes.

How can researchers distinguish between direct and indirect effects of FZD10 manipulation?

Distinguishing direct from indirect effects requires careful experimental design:

  • Temporal analysis: Examine effects at multiple time points after FZD10 manipulation. Direct effects typically manifest earlier than indirect effects.

  • Rescue experiments: Express different domains of FZD10 to determine which regions are necessary and sufficient for specific phenotypes.

  • Pathway inhibitor studies: Use inhibitors of downstream pathways to block secondary effects while preserving primary FZD10 functions.

  • Direct binding assays: Confirm physical interactions between FZD10 and proposed direct targets using techniques like co-immunoprecipitation or proximity ligation assays.

  • Rapid induction systems: Use inducible expression or degradation systems (e.g., AID, TIR1) to achieve acute FZD10 manipulation and focus on immediate consequences.

  • Single-cell analyses: Examine cellular responses at single-cell resolution to distinguish cell-autonomous from non-cell-autonomous effects.

In neural tube development studies, researchers used electroporation to target one side of the neural tube while using the contralateral side as an internal control. This approach helped distinguish between direct effects of FZD10 knockdown and broader developmental consequences .

What approaches help resolve discrepancies between in vitro binding studies and in vivo functional outcomes with FZD10?

To bridge the gap between in vitro and in vivo findings:

  • Ex vivo slice cultures: Use tissue slices that preserve native cellular architecture while allowing experimental manipulation and live imaging.

  • Organoid models: Develop 3D organoid cultures that recapitulate tissue organization and signaling environments more faithfully than 2D cultures.

  • Domain-specific mutations: Generate point mutations in specific FZD10 domains rather than complete knockout/knockdown to dissect structure-function relationships.

  • In vivo proximity labeling: Use techniques like BioID or APEX2 fused to FZD10 to identify physiologically relevant binding partners in living tissues.

  • Physiological ligand concentrations: Ensure in vitro studies use Wnt concentrations that approximate in vivo levels rather than excess amounts that may promote non-physiological interactions.

  • Context-dependent co-factors: Identify and include tissue-specific co-receptors or modulators in binding studies that may be essential for in vivo specificity.

Research has shown that FZD10 plays specific roles in neural development, mediating Wnt1 but not Wnt3a signaling . These findings highlight the importance of cellular context in determining FZD10 function, which may not be fully captured in simplified in vitro binding assays.

What are emerging technologies that might advance FZD10 research?

Several cutting-edge technologies show promise for advancing FZD10 research:

  • Single-cell multi-omics: Combining transcriptomics, proteomics, and epigenomics at single-cell resolution will help map FZD10 signaling networks in heterogeneous tissues.

  • Cryo-EM structures: Determining high-resolution structures of FZD10 in complex with different Wnt ligands and co-receptors will reveal molecular mechanisms of specificity.

  • Optogenetic and chemogenetic tools: Developing light- or drug-inducible FZD10 variants will enable precise spatial and temporal control of signaling.

  • Genome-wide CRISPR screens: Identifying genes that modify FZD10-dependent phenotypes will uncover new pathway components.

  • In situ transcriptomics: Technologies like Visium or MERFISH will map FZD10 expression and downstream effects with spatial resolution in intact tissues.

  • Human iPSC-derived models: Patient-derived cellular models will help translate FZD10 findings to human development and disease contexts.

These approaches will help address outstanding questions about FZD10 function in development and disease, particularly in complex tissues like the nervous system where FZD10 plays important roles in patterning and proliferation .

What is the potential of FZD10-targeted therapies in diseases with aberrant Wnt signaling?

FZD10 represents a promising therapeutic target in certain contexts:

  • Cancer applications: FZD10 is upregulated in some cancers and transformed cell lines . Its relatively restricted expression pattern in adult tissues makes it an attractive target with potentially limited off-target effects.

  • Neurodevelopmental disorders: Given FZD10's role in neural development and patterning , modulating its activity might address certain neurodevelopmental conditions with aberrant Wnt signaling.

  • Therapeutic approaches:

    • Neutralizing antibodies against the FZD10 extracellular domain

    • Recombinant FZD10-Fc proteins as decoy receptors

    • Small molecule inhibitors of FZD10-Wnt interactions

    • Peptide-based disruptors of protein-protein interactions

    • Gene therapy approaches to modulate FZD10 expression

Research has shown that FZD10 binds hypoxia inducible gene 2, which promotes oncogenic Wnt signaling and functions as an autocrine growth factor for renal cell carcinomas . This suggests potential applications in targeted cancer therapies with further development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.