Recombinant Human Frizzled-1 (FZD1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are happy to accommodate specific format requirements. Kindly include your desired format in the order notes, and we will prepare accordingly.
Note: While we prioritize shipping the format readily available in our inventory, we are happy to accommodate specific format requirements. Kindly include your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
FZD1; Frizzled-1; Fz-1; hFz1; FzE1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
70-647
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
VRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAY
NQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRS
LCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTS
NPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLM
YFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAY
IAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFL
AAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRG
FVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPAT
IVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLM
TLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
Uniprot No.
Target Background
Function
Frizzled-1 (FZD1) acts as a receptor for Wnt proteins. It is activated by WNT3A, WNT3, WNT1, and to a lesser extent WNT2, but not by WNT4, WNT5A, WNT5B, WNT6, WNT7A, or WNT7B. While there are conflicting reports regarding activation by WNT7B in mouse, FZD1 plays a crucial role in the canonical Wnt/beta-catenin signaling pathway. This pathway leads to activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for certain family members. However, it remains unclear if this represents a distinct pathway or integrates with the canonical pathway, as PKC appears to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. FZD1 may be involved in the transduction and intercellular transmission of polarity information during tissue morphogenesis or in differentiated tissues. Additionally, it acts as a receptor for C.difficile toxin TcdB in the colonic epithelium.
Gene References Into Functions
- FZD1 and CAIX may serve as significant biological markers for the carcinogenesis, metastasis, invasion, and prognosis of pancreatic ductal adenocarcinoma PMID: 28921449
- Our findings suggest that Sp1 plays a role in human osteoblast differentiation and mineralization, at least partially mediated by Sp1-dependent transactivation of FZD1. PMID: 27695039
- Amplification of miR-135b suppressed non-small cell lung cancer chemoresistance by directly mediating FZD1 down-regulation. PMID: 27643554
- FZD1 expression was down-regulated by AP2 expression and mediated osteoblast differentiation and mineralization. PMID: 25369469
- Our data indicate that FZD1 regulates PKCdelta, and the PKCdelta/AP-1 signaling transduction pathway plays a significant role in drug resistance in MES-SA/Dx5 cells. PMID: 24814288
- Polymorphisms in several genes involved in the Wnt signaling pathway were associated with hepatic fibrosis or inflammation risk in HCV-infected males. PMID: 24386373
- ACE2 and FZD1 are prognostic markers in squamous cell/adenosquamous carcinoma and adenocarcinoma of the gallbladder. PMID: 23921915
- Experiments demonstrate a role of E2F1 in osteoblast differentiation and mineralization, suggesting that FZD1 is required, in part, for E2F1 regulation of osteoblast mineralization. PMID: 23806799
- Fz1 is a Wnt responsive gene in colon-derived tissues. Fz1 expression exhibited increased expression in normal mucosa only in close proximity to colon cancer. PMID: 23442549
- FZD1 appears to mediate multidrug resistance by regulating the Wnt/beta-catenin pathway. PMID: 22484497
- Soluble FZC18 and Wnt3a physically interact in a cell-free system, and soluble FZC18 binds the frizzled 1 and 8 receptors. PMID: 22303445
- These results suggest that FZD1 expression is regulated in a haplotype-dependent manner in osteoblasts, and these same haplotypes may be associated with biomechanical indices of bone strength. PMID: 20051274
- Fz1 and LRP1 bind, which disrupts the receptor/coreceptor complex formation and leads to repression of the canonical Wnt signaling. PMID: 14739301
- Subcellular Fz localization, through association with other membrane proteins, is a critical aspect in regulating signaling specificity within the Wnt/Fz signaling pathways. PMID: 15252441
- Bone morphogenetic protein-2 modulates Wnt and frizzled expression and enhances the canonical pathway of Wnt signaling in normal keratinocytes. PMID: 16442268
- Data demonstrate that Frizzled receptors can functionally replace mating factor receptors in yeast, providing an experimental system to study modulators of Frizzled receptors. PMID: 17895994
- A frizzled module in cell surface collagen 18 inhibits Wnt/beta-catenin signaling. PMID: 18382662
- A cis-regulatory polymorphism in the FZD1 promoter region may have a functional role in determining bone structural geometry. PMID: 18715140
- The proportion of frizzled-1 positive ovaries was lower in normal patients than in those with ovarian cancer or benign neoplasia. PMID: 19148501
- FZD1 links epithelial/mesenchymal disruption to idiopathic pulmonary fibrosis. PMID: 17496152
Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in adult heart, placenta, lung, kidney, pancreas, prostate, and ovary and in fetal lung and kidney.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
