Recombinant Human Frizzled-7 (FZD7)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Biological Role

Recombinant Human FZD7 corresponds to residues 33–185 of the native FZD7 protein, encompassing its extracellular cysteine-rich domain (CRD) critical for ligand binding . This domain facilitates interactions with Wnt ligands (e.g., Wnt3a, Wnt8) and co-receptors like glypican-3 . As a class F G protein-coupled receptor (GPCR), FZD7 activates:

  • Canonical Wnt/β-catenin signaling: Promotes nuclear translocation of β-catenin, driving stem cell renewal and tumorigenesis .

  • Non-canonical pathways: Regulates planar cell polarity and calcium flux via Disheveled (DVL) and G-protein interactions .

Binding and Signaling

  • Wnt3a interaction: Exhibits high affinity (K<sub>D</sub>: 3.41 × 10<sup>−8</sup> M) via Biacore analysis .

  • DVL vs. G-protein coupling: Mutations in TM6-7 alter transducer selectivity (e.g., R6.32A impairs DVL recruitment) .

Anti-Tumor Activity

  • Triple-negative breast cancer (TNBC): Recombinant FZD7 (rhFZD7) inhibits proliferation (IC₅₀: ~10 µg/mL) and angiogenesis in MDA-MB-231 cells .

  • Synergy with chemotherapy: Enhances docetaxel efficacy in xenograft models .

A. Cancer Studies

  • Promoter-driven therapy: FZD7 promoter drives toxin expression (e.g., Shiga-like toxin) in tumors, reducing HepG2 xenograft growth by 60% .

  • Biomarker potential: Overexpressed in gastrointestinal, lung, and prostate cancers .

B. Stem Cell Regulation

  • Maintains embryonic stem cell pluripotency via β-catenin stabilization .

Clinical Implications

  • Targeted therapy: Soluble FZD7 fragments competitively inhibit Wnt3a, reducing metastasis in TNBC .

  • Diagnostic tool: FZD7 promoter activity correlates with tumor aggressiveness, detectable via GFP reporters .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
FZD7; Frizzled-7; Fz-7; hFz7; FzE3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-574
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKV QCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFP VHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPR QLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTV LTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTK KEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVK TITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRT IMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYA VPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGET AV
Uniprot No.

Target Background

Function
Frizzled-7 (FZD7) is a receptor for Wnt proteins. Most frizzled receptors are linked to the beta-catenin canonical signaling pathway, which activates disheveled proteins, inhibits GSK-3 kinase, promotes nuclear accumulation of beta-catenin, and activates Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for some family members, but it's unclear if it represents a distinct pathway or integrates with the canonical pathway. PKC appears necessary for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activation by WNT8 induces the expression of beta-catenin target genes. Upon ligand activation, FZD7 binds to CCDC88C/DAPLE, which displaces DVL1 from FZD7, leading to inhibition of canonical Wnt signaling, activation of G-proteins by CCDC88C, and triggering of non-canonical Wnt responses. FZD7 may be involved in the transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. In the context of microbial infection, FZD7 acts as a receptor for C.difficile toxin TcdB in the colonic epithelium.
Gene References Into Functions
  1. miR-504-mediated FZD7/Wnt/beta-catenin signaling pathway plays a significant role in hepatocellular carcinoma development. PMID: 30142536
  2. Elevated FZD7 expression is associated with Glioma. PMID: 30010402
  3. SOX8 binds to the promoter region of FZD7 and induces FZD7-mediated activation of the Wnt/beta-catenin pathway. This confers chemoresistance, stemness properties, and mediates epithelial mesenchymal transition in chemoresistant tongue squamous cell carcinoma. PMID: 29071717
  4. Frizzled 7 and phosphatidylinositol 4,5-diphosphate binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signaling. PMID: 27386966
  5. FZD7 may promote glioma cell proliferation via upregulation of TAZ. PMID: 27852064
  6. The miR-485-5p/FZD7 axis may provide novel insights into understanding the molecular pathogenesis of melanoma. PMID: 28364602
  7. FZD7 and IDH1 were assessed by immunohistochemistry in tissue microarrays. PMID: 27409829
  8. FZD7 transmits non-canonical Wnt signaling by interacting with Wnt5A in the regulation of extracellular matrix expression. PMID: 28736081
  9. Silencing of FZD7 inhibits the growth, migration, and invasion of esophageal squamous cell carcinoma cells. Silencing of FZD7 impedes the activation of Wnt signaling. PMID: 28669726
  10. Our study suggests that miR-542-3p inhibits HCC cell growth by targeting FZD7 and inhibiting the Wnt signaling pathway. Decreased miR-542-3p expression may contribute to the progression of HCC and may represent a novel molecular therapeutic target for HCC. PMID: 27815069
  11. Findings suggest that FZD7, involved in the canonical Wnt signaling pathway, plays a critical role in mediating BMSCs-dependent protection of CML cells. PMID: 26716419
  12. Results found that FZD7 was highly upregulated by H. pylori infection and was associated with H. pylori infection-induced cell proliferation. PMID: 26780940
  13. This paper suggests that Fzd7 may act as one of the molecules involved in the formation of renal cell carcinoma. PMID: 26243397
  14. FZD7 is a unique and nonredundant target of NOTCH3 in human breast epithelial cells. PMID: 26847503
  15. SNX27 inhibits the Wnt regulated transcription activity of TCF/LEF. Our results suggest that SNX27 interacts with Frizzled receptors to regulate the endocytosis and stability of Fzds. PMID: 26744382
  16. Data show that cell proliferation and tumor growth decreased significantly after transfection with the plasmid frizzled 7 protein (FZD7)-Shiga-like toxin I (Stx1). PMID: 26498690
  17. FZD7 activated JNK in melanoma cell lines in vitro, and the expression of a dominant negative JNK suppressed metastasis formation in vivo, suggesting that FZD7 may promote metastatic growth of melanoma cells via activation of JNK. PMID: 26808375
  18. Our study suggests that miR-613 functions as a tumor suppressor, partially through targeting Fzd7, and is a potential therapeutic target for prostate cancer. PMID: 26703210
  19. High FZD7 expression is associated with cell migration, invasion, and epithelial-mesenchymal transition of cervical cancer. PMID: 25740178
  20. High expression of FZD7 is associated with cervical cancer. PMID: 25976503
  21. Frizzled 7 expression is positively regulated by SIRT1 and beta-catenin in breast cancer cells. PMID: 24897117
  22. Expression of FZD7 was inversely correlated with miR-199a in both hepatocellular carcinoma tissues and cells. Over-expression of miR-199a significantly down-regulates the expression of genes downstream of FZD7. PMID: 25313882
  23. Knockdown of FZD7 in Stem-A subtype of ovarian cancer cells showed reduced cell proliferation with an increase in the G0/G1 sub-population. PMID: 25032869
  24. Findings suggest that Wnt signaling is one of the factors of the LSC niche, and Fz7 helps to maintain the undifferentiated state of LSCs. PMID: 24170316
  25. Data indicate that Wnt receptor Fzd7-dependent enhancement of Wnt signalling by DeltaNp63 governs tumor-initiating activity of the basal subtype of breast cancer. PMID: 25241036
  26. Results demonstrate that FZD7 encodes a regulator of the pluripotent state and that hESCs require endogenous WNT/beta-catenin signaling through FZD7 to maintain an undifferentiated phenotype. PMID: 24474766
  27. Our findings suggest that the FZD7-involved canonical Wnt signaling pathway is essential for tumorigenesis of TNBC. PMID: 21532620
  28. Variable FZD7 expression in colorectal cancers indicates regulation by the tumor microenvironment. PMID: 19655379
  29. FZD7 plays a pivotal role in morphology transitions associated with colon tumor initiation and progression. PMID: 15901282
  30. During development, FZD7 orchestrates either migratory or epithelialization, which implicates similar functional diversity for FZD7 during colorectal cancer development. PMID: 17016432
  31. These findings pinpoint calpain-1 as a regulator of Frizzled-7 turnover at the plasma membrane and reveal a link between Frizzled-7 cleavage and its activity. PMID: 17716656
  32. Syntenin stimulates c-jun phosphorylation and modulates Frizzled 7 signaling, particularly the PKCalpha/CDC42 noncanonical Wnt signaling cascade. PMID: 18256285
  33. FZD7-siRNA may be used as a therapeutic reagent for colorectal cancer. PMID: 18592008
  34. Findings identify the WNT receptor FZD7 as a novel ES cell-specific surface antigen with a likely important role in maintaining ES cell self-renewal capacity. PMID: 18681827
  35. FZD7 may be involved in enhancing the survival, invasion, and metastatic capabilities of colon cancer cells through non-canonical Wnt signaling pathways, as well as the canonical pathway. PMID: 19773752

Show More

Hide All

Database Links

HGNC: 4045

OMIM: 603410

KEGG: hsa:8324

STRING: 9606.ENSP00000286201

UniGene: Hs.173859

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.
Tissue Specificity
High expression in adult skeletal muscle and fetal kidney, followed by fetal lung, adult heart, brain, and placenta. Specifically expressed in squamous cell esophageal carcinomas.

Q&A

What is the molecular structure of human FZD7 receptor?

FZD7 is a 574 amino acid seven-transmembrane protein located on human chromosome 2q33. Its structure includes an N-terminal signal peptide, an extracellular cysteine-rich domain (CRD), a seven-pass transmembrane domain, and an intracellular C-terminal PDZ domain. The CRD enables FZD7 to interact with Wnt proteins, while the PDZ domain interacts with disheveled (Dvl) to transduce downstream Wnt signals . The "neck" region between the CRD and first transmembrane domain contains unique epitopes that can be targeted by specific antibodies. Position 188 (leucine in human FZD7) in this region is particularly critical for antibody binding specificity .

How does FZD7 participate in Wnt signaling pathways?

FZD7 functions as a receptor for Wnt proteins and can activate both canonical (β-catenin-dependent) and non-canonical Wnt signaling pathways. In the canonical pathway, Wnt proteins bind to FZD7's CRD, causing FZD7 to heterodimerize with LRP5/6 co-receptors. This interaction recruits Disheveled (Dvl) through the PDZ domain, preventing β-catenin degradation. Accumulated β-catenin then translocates to the nucleus to activate TCF/LEF transcription factors, leading to expression of genes involved in proliferation and differentiation . Research indicates that FZD7 can form higher-order oligomers with LRP6, potentially enhancing signaling amplitude through receptor clustering and intracellular signalosome formation .

How does FZD7 differ from other Frizzled family members?

Among the 10 members of the Frizzled family, FZD7 is uniquely conserved in its role regulating developing gastric systems . While it shares high homology with FZD1 (79% identical) and FZD2 (80% identical), the "neck" region between the CRD and first transmembrane domain contains distinguishing features that can be targeted by specific antibodies . FZD7 is also the most commonly upregulated Frizzled receptor across multiple cancer types, particularly in colorectal cancer, hepatocellular carcinoma, and triple negative breast cancer . This distinct expression pattern and evolutionary conservation suggest specialized functions not fully shared with other family members.

What approaches can be used to design recombinant FZD7 proteins?

Multiple design strategies for recombinant FZD7 have been documented in research:

  • Soluble peptide fragments (rhFZD7): Focused on the extracellular domain to competitively bind with Wnt ligands, functioning as antagonists of endogenous FZD7 signaling .

  • Single-chain variable fragments (scFv): Derived from variable regions of FZD7-targeting antibodies, often fused to Fc regions of human IgG. A typical format includes IL-2 signal sequence + F7-VH + (GGGGS)3 linker + F7-VL + Fc .

  • Bispecific constructs: Target both FZD7 and co-receptors like LRP6, with structures such as: IL-2 ss + F7-VH + (GGGGS)3 + F7-VL + (GGGGS)3 + L6-VL + (GGGGS)4 + L6-VH + Fc .

These designs can be customized based on research requirements, with variations in valency, domain composition, and therapeutic orientation significantly affecting experimental outcomes.

How can the binding specificity of recombinant FZD7 be validated?

Validating binding specificity is critical for reliable experimental outcomes. Recommended methods include:

  • Cross-reactivity testing: Overexpress individual FZD1-10 proteins in cell lines (e.g., HEK293T) and test antibody binding by immunoblotting while confirming cell surface expression using confocal microscopy .

  • Epitope mapping: Generate fusion proteins between GST and FZD7 domains with sequential shortenings to map binding to specific amino acid regions. In one study, researchers mapped an antibody's epitope to an eight amino acid stretch containing L188 .

  • Mutational analysis: Create point mutations at candidate positions (e.g., L188P in human FZD7) to test if they abolish antibody binding. A single amino acid change at position 188 from leucine to proline (P188) rendered human FZD7 non-reactive to an FZD7-specific antibody .

  • Binding kinetics: Use systems like Biacore X100 to monitor binding kinetics between recombinant FZD7 and Wnt ligands. One study showed rhFZD7 bound to Wnt3a with high affinity (KD: 3.41 × 10-8 M) .

What expression systems are optimal for producing recombinant FZD7 proteins?

Mammalian expression systems are predominantly used for producing recombinant FZD7 proteins due to their ability to perform proper post-translational modifications. Common approaches include:

  • Mammalian expression vectors: Vectors like pFuse-hIgG1-Fc2 containing the IL-2 signal sequence and IgG1 crystallizable fragment (Fc) are commonly used .

  • Purification strategies: Incorporation of purification tags (e.g., 6xHis tag) between the IL-2 signal sequence and the protein of interest facilitates downstream purification .

  • Secretion systems: Utilizing the IL-2 signal sequence directs the recombinant protein through the secretory pathway, often resulting in higher yields of properly folded protein .

These expression systems can be optimized based on the specific recombinant FZD7 construct and intended application.

How is FZD7 involved in cancer development and progression?

FZD7 plays significant roles in multiple aspects of cancer biology:

  • Aberrant pathway activation: FZD7 modulates tumorigenesis through aberrant activation of the Wnt/β-catenin pathway, promoting cell proliferation, invasion, and resistance to apoptosis .

  • Tumor angiogenesis: FZD7 contributes to tumor angiogenesis, with inhibition of FZD7 showing anti-angiogenic effects in triple negative breast cancer models both in vitro and in vivo .

  • Cancer-specific upregulation: FZD7 is the most commonly upregulated Frizzled receptor across multiple cancer types, suggesting a selective advantage for cancer cells expressing this receptor .

  • Therapy resistance: Some evidence suggests FZD7 may contribute to chemotherapy resistance, with studies showing that rhFZD7 can sensitize triple negative breast cancer cells to the anti-tumor effects of Docetaxel .

Which cancer types show elevated FZD7 expression?

Several cancer types demonstrate significant FZD7 upregulation:

Cancer TypeFZD7 Expression PatternKey FindingsReference
Triple Negative Breast Cancer (TNBC)Significantly upregulatedModulates tumorigenesis through Wnt signaling
Colorectal CancerCommonly upregulatedContributes to development and progression
Hepatocellular CarcinomaOverexpressedAssociated with tumor progression
Esophageal CarcinomaFzE3 variant isolated (98% homology with FZD7)Potential role in carcinogenesis
Intestinal CancerProminently expressedImportant drug development target

This expression pattern makes FZD7 a promising biomarker and therapeutic target across multiple tumor types.

How can recombinant FZD7 proteins be used in cancer research?

Recombinant FZD7 proteins have multiple applications in cancer research:

  • Competitive inhibition: Soluble rhFZD7 can act as a decoy receptor by binding to Wnt ligands, preventing their interaction with endogenous FZD7 and inhibiting downstream signaling .

  • Anti-tumor activity assessment: Studies demonstrate that rhFZD7 inhibits proliferation and invasion of TNBC cells while inducing apoptosis and repressing tumor angiogenesis both in vitro and in vivo .

  • Combination therapy research: rhFZD7 can sensitize TNBC cells to the anti-tumor effects of chemotherapeutics like Docetaxel, enabling exploration of synergistic treatment approaches .

  • Screening platform development: Recombinant FZD7 provides a foundation for screening anti-FZD7 antibodies and identifying novel therapeutic candidates .

  • Mechanistic studies: FZD7 constructs enable investigation of specific roles in canonical versus non-canonical Wnt pathway activation in different cancer contexts .

Experimental Methods for FZD7 Research

Screening for FZD7 inhibitors presents several challenges, particularly regarding false positives:

  • Luciferase interference: Many compounds directly inhibit Firefly luciferase activity. For example, compound 28 showed inhibition in TOPFlash assays (IC50 = 30 nM) but was later identified as a direct Firefly luciferase inhibitor. Always counter-screen compounds directly against purified luciferase enzyme .

  • Multiple orthogonal assays: Validate hits using assays based on different detection technologies. Combine reporter assays with BRET biosensors and qPCR of endogenous target genes (e.g., Axin2) .

  • Chemical filters: Apply filters to detect problematic scaffolds and screen for previously reported luciferase inhibitors before conducting biological assays .

  • Docking parameter evaluation: Establish guidelines with cost-effective pipelines, including specific controls for identifying spectroscopic interference and testing for off-target activity early in the screening process .

  • Structure-activity relationship analysis: Generate analogs of hit compounds to identify essential pharmacophore features and verify that structural modifications affect biological activity rather than just assay interference .

What in vivo models are appropriate for studying FZD7 function?

Several in vivo models have been utilized to study FZD7 function in different contexts:

  • Xenograft tumor models: Human cancer cell lines (particularly TNBC) implanted in immunodeficient mice can evaluate the effects of FZD7 inhibition on tumor growth, metastasis, and response to therapy .

  • Combination therapy models: Adding FZD7 inhibitors to standard chemotherapeutics (e.g., Docetaxel) in xenograft models can assess potential synergistic effects and mechanisms of chemosensitization .

  • Angiogenesis models: Chick chorioallantoic membrane assays can evaluate the anti-angiogenic effects of FZD7 inhibition, as demonstrated with rhFZD7 in TNBC models .

  • Embryonic development models: Given FZD7's role in stem cell maintenance and mesendodermal differentiation, developmental models can provide insights into its normal physiological functions .

  • Genetic knockout models: Tissue-specific or inducible FZD7 knockout models can help distinguish its roles in different tissues and developmental stages while avoiding compensatory mechanisms.

How does the valency of FZD7 constructs affect signaling outcomes?

The valency of FZD7 constructs significantly impacts signaling dynamics:

  • Tetravalent vs. bivalent constructs: Tetravalent constructs (e.g., F7L6) that bind two FZD7 and two LRP6 receptors show approximately twofold greater signal saturation compared to bivalent constructs (F7L6-sc) that form 1:1 FZD7-LRP6 heterodimers .

  • Receptor oligomerization: Higher-order oligomers may promote optimal downstream signaling. Tetrameric ligands can augment signaling by promoting receptor clustering, potentially through polymerization of intracellular scaffolding molecules like DVL and AXIN to drive signalosome formation .

  • Signaling amplitude control: While a 1:1 FZD7-LRP6 interaction is sufficient for signaling initiation, higher valency appears to control signal amplitude, which may have important implications for biological outcomes .

  • Therapeutic implications: Different valency constructs may be preferred depending on whether agonistic or antagonistic effects are desired in specific research or therapeutic contexts .

What are the challenges in developing FZD7-specific targeting agents?

Developing truly specific FZD7-targeting agents faces several challenges:

  • Family homology: FZD family members share high sequence homology, particularly FZD1 (79% identical to FZD7) and FZD2 (80% identical to FZD7), creating specificity challenges .

  • Unique targeting regions: The "neck" region between the CRD and first transmembrane domain represents one of the few areas with sufficient variability for specific targeting. Position 188 (leucine in human FZD7) has been identified as critical for antibody specificity .

  • Species differences: Despite high conservation between human and mouse FZD7, some antibodies only recognize the human version, necessitating careful validation for preclinical studies .

  • Functional redundancy: Multiple FZD receptors can activate similar pathways, potentially limiting efficacy of single-target approaches through compensatory mechanisms.

  • Context-dependent effects: FZD7 can activate different downstream pathways depending on cellular context, making therapeutic outcomes difficult to predict across different tissues or disease states.

How can FZD7 be effectively targeted in stem cell research?

FZD7 plays crucial roles in stem cell biology that can be leveraged in research:

  • Maintenance of pluripotency: FZD7 is essential for maintaining human embryonic stem cells (hESCs) in an undifferentiated and pluripotent state through an endogenous WNT signaling loop .

  • Directed differentiation: Selective engagement and activation of FZD7 signaling is sufficient to promote mesendodermal differentiation of human pluripotent stem cells, suggesting potential applications in regenerative medicine .

  • FZD7-specific tools: FZD7-specific antibodies (e.g., F7-Ab) and bispecific constructs (e.g., F7L6) that specifically activate FZD7 signaling can be used to precisely modulate stem cell fate decisions .

  • Cancer stem cells: Given FZD7's role in both cancer and stem cell biology, targeting this receptor may provide opportunities to specifically eliminate cancer stem cell populations while sparing normal tissue stem cells .

  • Regenerative medicine applications: Understanding FZD7's role in differentiation pathways could enable better control of stem cell differentiation protocols for tissue engineering and cell replacement therapies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.