Recombinant Human Frizzled-9 (FZD9)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Wnt Signaling

FZD9 mediates both canonical (β-catenin-dependent) and non-canonical (β-catenin-independent) Wnt pathways, depending on ligand binding and cellular context.

Canonical Signaling

  • Wnt-2 Activation: Overexpression of FZD9 induces β-catenin stabilization and TCF-dependent transcription, as shown in 293T cells .

  • Bone Mineralization: FZD9 is required for osteoblast differentiation and bone matrix mineralization, acting via canonical Wnt/β-catenin signaling .

Non-Canonical Signaling

  • Wnt-5a and Calcium Signaling: FZD9 binds Wnt-5a, triggering calcium influx and dendritic spine formation in hippocampal neurons .

  • Fracture Healing: Non-canonical FZD9 signaling promotes intramembranous and endochondral bone formation during fracture repair .

Neurological Functions

  • Hippocampal Synaptic Plasticity: FZD9 interacts with Gαo proteins to mediate Wnt-5a-induced calcium signaling and dendritic spine density .

  • Hearing Progenitor Cells: FZD9+ cells in the neonatal cochlea generate hair cells in vivo and form spheres in vitro, marking them as progenitors .

Skeletal and Muscular Roles

  • Osteoblast Differentiation: FZD9 knockout mice exhibit reduced bone formation rates (45% decrease) due to impaired matrix mineralization .

  • Fracture Healing: Non-canonical FZD9 signaling enhances osteoblast activity and accelerates bone repair .

Cancer and Developmental Disorders

  • Williams Syndrome: Deletion of FZD9 in the Williams syndrome region may contribute to cognitive deficits .

  • Lung Cancer: FZD9 activation by Wnt-7a inhibits cancer cell growth via non-canonical pathways .

Post-Translational Modifications and Regulation

FZD9 activity is modulated by phosphorylation and ubiquitination:

  • Phosphorylation: Casein kinase I and PKC phosphorylate FZD9’s C-terminal domain, regulating its interaction with Dishevelled (Dvl) .

  • Ubiquitination: ZNRF3/RNF43-mediated ubiquitination promotes FZD9 internalization and degradation, limiting Wnt signaling .

Future Directions

Recombinant FZD9 offers tools for exploring therapeutic strategies, including:

  • Bone Regeneration: Targeting FZD9 to enhance fracture healing or osteoporosis treatment .

  • Neurological Disorders: Investigating FZD9’s role in hippocampal learning deficits (e.g., Williams syndrome) .

  • Cancer Therapy: Developing FZD9 antagonists to block Wnt-driven tumor growth .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
FZD9; FZD3; Frizzled-9; Fz-9; hFz9; FzE6; CD antigen CD349
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-591
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
LEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQY GCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARL PTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGSGTCENPEKF QYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQY PERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYY FGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGD ELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTGFVALFHIRKIMKTGGTNTEKLE KLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCAAAAGPGGRRDCSLPGG SVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKIAAGRARAKACRAPGSYG RGTHCHYKAPTVVLHMTKTDPSLENPTHL
Uniprot No.

Target Background

Function

Frizzled-9 (FZD9) is a receptor for Wnt2, mediating the canonical beta-catenin signaling pathway. This pathway activation involves disheveled proteins, GSK-3 kinase inhibition, nuclear beta-catenin accumulation, and subsequent activation of Wnt target genes. FZD9 plays a crucial role in neuromuscular junction (NMJ) assembly by negatively regulating acetylcholine receptor (AChR) clustering. It also influences neural progenitor cell (NPC) viability and hippocampal development by modulating cell cycle arrest and apoptosis. Additionally, FZD9 contributes to bone formation and regeneration through non-canonical Wnt signaling, possibly involving ISG15.

Gene References Into Functions
  1. FZD9 methylation profile suggests a tumor suppressor role in acute myeloid leukemia. PMID: 27314612
  2. The FZD9/Wnt pathway is implicated in the proliferation and differentiation of periodontal ligament mesenchymal stem cells. PMID: 20458727
  3. Wnt7A/FZD9 signaling upregulates Sprouty4 promoter activity via peroxisome proliferator-activated receptor gamma in lung cancer cells. PMID: 20501643
  4. The FZD9/Wnt pathway is implicated in the proliferation and differentiation of periodontal ligament mesenchymal stem cells. PMID: 20458727
  5. FZD9 transfection confers Wnt-7a sensitivity to Wnt-7a-insensitive NSCLC cell lines. PMID: 15705594
  6. Aberrant FZD9 DNA methylation is linked to myelodysplastic syndrome progression to acute myeloid leukemia. PMID: 18832655
  7. Frizzled-9 siRNA suppresses hepatoma cell proliferation and motility. PMID: 19724923
Database Links

HGNC: 4047

OMIM: 601766

KEGG: hsa:8326

STRING: 9606.ENSP00000345785

UniGene: Hs.647029

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in adult and fetal brain, testis, eye, skeletal muscle and kidney. Moderately expressed in pancreas, thyroid, adrenal cortex, small intestine and stomach. Detected in fetal liver and kidney. Expressed in neural progenitor cells.

Q&A

What is Frizzled-9 and what are its basic structural characteristics?

Frizzled-9 (FZD9), also designated as CD349 (cluster of differentiation 349), is a protein encoded by the FZD9 gene in humans. It belongs to the 'frizzled' gene family, which encodes 7-transmembrane domain proteins that function as receptors for Wnt signaling proteins. This G protein-coupled transmembrane receptor is predominantly expressed in brain, testis, eye, skeletal muscle, and kidney tissues . The protein structure includes an extracellular cysteine-rich domain (CRD) that serves as the binding site for Wnt ligands, seven transmembrane domains, and an intracellular domain that interacts with downstream signaling molecules such as Dishevelled.

What is the chromosomal location of FZD9 and why is it significant?

The FZD9 gene is located within the chromosomal region 7q11.23, which is particularly significant because it falls within the Williams syndrome common deletion region. Heterozygous deletion of the FZD9 gene may contribute to the Williams-Beuren syndrome phenotype, a neurodevelopmental disorder characterized by cognitive impairments, distinctive facial features, and cardiovascular abnormalities . This genomic location has made FZD9 an important target for researchers studying developmental disorders and the specific contributions of individual genes to complex syndromic presentations.

What cellular models are most appropriate for studying FZD9 function?

Several cellular models have proven effective for studying FZD9 function. The 293T cell line has been successfully used to demonstrate that rat Frizzled-9 functions in Wnt/beta-catenin signaling . For lung-specific research, human bronchial epithelial cells (HBECs) have been employed to study the effects of FZD9 knockdown on epithelial phenotype . Researchers should select cellular models based on their expression profiles and the specific signaling pathway under investigation. When examining the tumor-suppressive role of FZD9, lung epithelial cells and non-small cell lung cancer (NSCLC) lines are appropriate. For studying its role in neurological development, neuronal cell lines or primary neuronal cultures from relevant brain regions would be more suitable.

How can researchers effectively measure FZD9-mediated activation of downstream signaling?

Several methodological approaches can effectively measure FZD9-mediated downstream signaling:

  • TCF-dependent transcription assays: These reporter assays measure β-catenin-mediated transcriptional activation using luciferase reporters containing TCF binding sites .

  • PPRE (Peroxisome Proliferator Response Element) luciferase assays: For measuring PPARγ activation downstream of FZD9, particularly in lung models where FZD9-WNT7a signaling activates PPARγ through an Erk5-dependent cascade .

  • Immunoblotting for phosphorylated Dishevelled: FZD9 overexpression induces hyperphosphorylation of Dishevelled-1 (Dvl-1), which can be detected via Western blotting as a mobility shift .

  • Cytosolic β-catenin accumulation: Quantifying cytosolic or nuclear β-catenin levels via fractionation and immunoblotting or immunofluorescence microscopy .

  • Bioluminescence Resonance Energy Transfer (BRET) sensors: Advanced approaches using unimolecular FZD-DEP sensors can detect conformational changes upon ligand binding, allowing real-time monitoring of receptor activation .

What approaches can be used to study FZD9-Dishevelled interactions?

FZD9-Dishevelled interactions can be studied using several complementary approaches:

  • Co-immunoprecipitation assays to detect physical interactions between FZD9 and Dishevelled proteins.

  • Immunofluorescence microscopy to visualize Dishevelled relocalization from the cytoplasm to the cell membrane upon FZD9 activation .

  • Unimolecular FZD-DEP-Clamp biosensors that incorporate both FZD9 and the DEP domain of Dishevelled, allowing direct measurement of their interaction through BRET signals .

  • Deletion mutant analysis to identify specific residues required for FZD9-Dishevelled interaction, as demonstrated by studies showing differences in C-terminal residues required for Dvl-1 modifications versus those required for β-catenin stabilization .

  • Live-cell imaging with fluorescently tagged proteins to monitor dynamic interactions in real-time.

How does FZD9 function in cancer biology, and does it exhibit context-dependent roles?

FZD9 exhibits remarkable context-dependent roles in cancer biology, functioning as either an oncogene or a tumor suppressor depending on the tissue type and specific signaling pathway engaged:

  • Tumor Suppressive Role: In lung tissue, FZD9 interacts with WNT7a to signal through peroxisome proliferator activated receptor gamma (PPARγ) via an Erk5-dependent cascade, leading to anti-tumor signaling. This pathway increases epithelial gene expression while reducing mesenchymal gene expression . Loss of FZD9 in non-small cell lung cancer (NSCLC) cell lines leads to increased transformed growth and decreased PPARγ signaling.

  • Oncogenic Role: Conversely, in other cancers including astrocytoma, osteosarcoma, acute myeloid leukemia, and hepatocellular carcinoma, FZD9 interactions with WNT2, WNT5a, and WNT3a activate β-catenin signaling, promoting epithelial-mesenchymal transition (EMT) and invasiveness .

These contrasting roles make FZD9 a complex target for cancer research and highlight the importance of tissue-specific context in Wnt signaling studies.

What phenotypes are observed in FZD9 knockout models?

FZD9 knockout models have revealed several important phenotypes:

  • FZD9 -/- mice show no significant physiologic or anatomic effects up to one year of age under normal conditions, suggesting possible compensatory mechanisms .

  • When challenged with urethane in a lung adenocarcinoma model, FZD9 -/- mice showed a trend toward increased adenoma multiplicity compared to wild type mice (p=0.08) .

  • Loss of FZD9 in mouse models has been associated with slight abnormality in B-cell development, impaired osteoblast function, and learning defects .

  • At the molecular level, serum from FZD9 -/- mice showed significantly lower PPARγ activation compared to wild type mice, indicating reduced PPARγ signaling when FZD9 is lost in vivo .

  • FZD9 -/- mice exposed to urethane showed increased COX2 expression compared to saline controls .

  • Adenoma cell lines derived from FZD9 -/- mice exhibited higher expression of mesenchymal markers (vimentin), inflammatory markers (COX2), increased active β-catenin, and reduced expression of epithelial markers (E-cadherin) compared to wild type adenoma cells .

How does the FZD9 signaling cascade differ between canonical and non-canonical Wnt pathways?

FZD9 can engage both canonical (β-catenin-dependent) and non-canonical (β-catenin-independent) Wnt pathways, with distinct downstream signaling cascades:

  • Canonical Wnt/β-catenin Pathway:

    • FZD9 overexpression induces hyperphosphorylation and relocalization of Dishevelled-1 (Dvl-1) from the cytoplasm to the cell membrane

    • This leads to accumulation of cytosolic β-catenin

    • Rfz9 transfection with Wnt-2 activates TCF-dependent transcription

    • Deletion mutant analysis shows different C-terminal residues are required for Dvl-1 modifications versus β-catenin stabilization

    • FZD9 can relocalize Axin from the cytoplasm to the plasma membrane in the presence of Dvl-1

  • Non-canonical Wnt Pathway (specifically in lung tissue):

    • FZD9 interacts with WNT7a to activate PPARγ through an Erk5-dependent cascade

    • This leads to anti-tumor signaling, including increased epithelial and reduced mesenchymal gene expression

    • This pathway appears to be tumor-suppressive, in contrast to the often proliferative canonical pathway

The engagement of different Wnt ligands (Wnt-2 vs. WNT7a) appears to be a key determinant in whether FZD9 activates canonical or non-canonical signaling.

What is the significance of the DEP domain interaction with FZD9?

The DEP domain of Dishevelled proteins plays a crucial role in FZD9 signaling:

  • Unimolecular FZD-DEP-Clamp biosensors demonstrate that the DEP domain can tightly bind or "clamp" to the receptor core of FZD9 .

  • Mutations in the finger loop of the DEP domain (equivalent to the L445E mutation of DVL2) can abolish the interaction between FZD and DEP, forcing the sensor into an open state and resulting in a decreased BRET ratio .

  • The DEP domain interaction with FZD9 appears to be crucial for proper signal transduction, as demonstrated by experiments showing WNT-specific dynamic increases in BRET in FZD9-DEP-Clamp biosensors in response to WNT ligands .

  • This interaction may represent a critical regulatory mechanism for controlling FZD9 signaling activity and specificity, potentially serving as a molecular switch between different downstream signaling pathways.

How do deletion mutations in FZD9 affect its signaling capabilities?

Deletion mutations in FZD9 have revealed important insights about structure-function relationships:

  • Deletion of the Wnt-binding domain (CRD) does not completely abolish Rfz9 activity, although it causes inactivation of Wnt-2-dependent TCF transcription . This suggests that some FZD9 functions may be ligand-independent or that the receptor maintains partial functionality even without direct Wnt binding.

  • Deletion mutant analysis determined differences in FZD9 C-terminal residues required for:

    • Modifications of Dvl-1

    • Inductions of β-catenin stabilization and TCF transactivation

  • These findings indicate that different regions of FZD9 are responsible for distinct downstream signaling events, suggesting a modular organization of signaling functions.

  • Removal of the extracellular CRD (the WNT binding site) prevents WNT-stimulated BRET changes in FZD-DEP-Clamp biosensors, confirming the specificity of the observed signals and the requirement of this domain for WNT-induced conformational changes .

What are the key considerations when designing recombinant FZD9 protein for functional studies?

When designing recombinant FZD9 protein for functional studies, researchers should consider several critical factors:

  • Domain Preservation: Ensure the cysteine-rich domain (CRD) is properly folded as it's essential for Wnt ligand binding. The correct formation of disulfide bonds in this region is critical for functionality.

  • Transmembrane Domain Handling: As a 7-transmembrane protein, FZD9 requires special consideration for maintaining structural integrity. For soluble versions, decisions must be made about which domains to include or exclude.

  • Post-translational Modifications: Consider the impact of glycosylation and other post-translational modifications on FZD9 function. Expression systems should be selected based on their ability to perform these modifications properly.

  • Fusion Tags: Strategic placement of tags (His, FLAG, etc.) is crucial to avoid interference with protein function. C-terminal tags may affect interaction with Dishevelled, as C-terminal residues of FZD9 are critical for different aspects of downstream signaling .

  • Expression Systems: Selection between mammalian, insect, or bacterial expression systems should be based on the specific research needs and the importance of post-translational modifications.

  • Purification Strategy: Developing effective purification protocols for membrane proteins like FZD9 requires careful consideration of detergents and buffer conditions to maintain protein stability and function.

What methodologies are most effective for studying FZD9 in the context of Williams syndrome research?

For Williams syndrome research involving FZD9, several methodological approaches are particularly effective:

  • Patient-derived iPSCs: Induced pluripotent stem cells from Williams syndrome patients allow for the study of FZD9 haploinsufficiency in human neural development and function.

  • CRISPR/Cas9 Gene Editing: Creating precise deletions or mutations in FZD9 in cellular or animal models enables the study of FZD9's specific contribution to Williams syndrome phenotypes.

  • Conditional Knockout Models: Tissue-specific and temporally controlled FZD9 deletion can help dissect its role in different developmental stages and tissues affected in Williams syndrome.

  • Comparative Studies: Analyzing FZD9 expression and function in tissues from Williams syndrome patients compared to controls can provide insights into pathological mechanisms.

  • Behavioral Testing: For animal models with FZD9 alterations, comprehensive behavioral assessments that parallel Williams syndrome cognitive and social phenotypes are essential.

  • Neuroimaging: Structural and functional neuroimaging of models with FZD9 alterations can reveal insights into brain development and function relevant to Williams syndrome.

What are the technical challenges in measuring WNT7a-FZD9-PPARγ signaling in lung epithelial models?

Measuring the tumor-suppressive WNT7a-FZD9-PPARγ signaling pathway in lung epithelial models presents several technical challenges:

  • Pathway Complexity: The signaling involves multiple intermediates including an Erk5-dependent cascade, requiring measurement at multiple points to fully characterize the pathway.

  • Physiological Relevance: Ensuring experimental conditions adequately reflect in vivo conditions, as demonstrated by the observation that serum from FZD9 -/- mice showed significantly lower PPARγ activation than wild type mice .

  • Cell Type Specificity: Different lung cell types may exhibit variable responses to WNT7a-FZD9 signaling, necessitating careful selection of cellular models.

  • Temporal Dynamics: Capturing the appropriate timepoints for measuring transient signaling events and distinguishing immediate versus long-term effects of pathway activation.

  • Quantification Methods: Developing reliable assays for PPARγ activation, such as PPRE-luciferase reporter assays as used in studies with FZD9 -/- mouse serum .

  • Compensatory Mechanisms: Accounting for potential compensatory pathways that may activate when FZD9 is lost, as suggested by the relatively mild phenotype of FZD9 -/- mice under normal conditions .

  • Context-Dependent Effects: The same pathway may produce different outcomes depending on the cellular context and the presence of other signaling molecules or genetic alterations.

What control experiments are essential when conducting FZD9 ligand binding studies?

When conducting FZD9 ligand binding studies, several critical control experiments should be included:

  • Heat-inactivated WNT Controls: WNT proteins subjected to heat inactivation should be used as negative controls to confirm signal specificity, as demonstrated in experiments where heat-inactivated WNT-16B failed to induce BRET responses in FZD-DEP-Clamps .

  • CRD Deletion Controls: Testing receptors lacking the extracellular cysteine-rich domain (CRD) is essential to confirm binding specificity, as shown in experiments where removal of the CRD prevented WNT-stimulated BRET changes .

  • Competitive Binding Assays: Using known FZD9 ligands (like WNT2) to compete with test ligands helps confirm binding site specificity.

  • Cross-Reactivity Controls: Testing ligand binding to other Frizzled family members helps establish FZD9 selectivity profiles.

  • Dose-Response Relationships: Establishing complete dose-response curves is necessary to determine binding affinity and potential cooperative effects.

  • Specificity Controls: Demonstrating that effects are truly FZD9-dependent by using FZD9 knockout models or siRNA knockdown approaches.

  • Functional Validation: Confirming that ligand binding translates to functional outcomes through downstream signaling assays measuring β-catenin accumulation, TCF-dependent transcription, or PPARγ activation depending on the pathway of interest.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.