Recombinant Human Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2 (CMTR2)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

Recombinant CMTR2 demonstrates:

  • Cofactor dependence: Requires S-adenosyl methionine (SAM) for methyl group transfer

  • Positional specificity: Methylates the 2'-OH of the second nucleotide (N2) in capped RNA (cap1 → cap2 conversion)

  • Substrate flexibility: Functions independently of prior N7-methylguanosine or cap1 methylation

Key biochemical properties:

  • Optimal activity at physiological pH (7.4–7.8) and 37°C

  • No activity on single-stranded DNA or uncapped RNA

  • Cytoplasmic localization enables post-nuclear modification events

Functional Roles in mRNA Processing

CMTR2 contributes to:

Immune Evasion

  • Prevents recognition by RIG-I-like receptors through cap2 formation

  • No observed interferon response in CMTR2-knockout cells, suggesting alternative immune mechanisms

Transcriptome Regulation

  • Modulates mRNA stability: Cap2 mRNAs show 2.3× longer half-life than cap0 counterparts

  • Enhances translation efficiency by 40–60% in reporter assays

Developmental Functions

Mouse knockout studies reveal:

  • Embryonic lethality at E12.5 due to placental/vascular defects

  • Reduced hematopoietic stem cell proliferation (↓58% in yolk sac)

  • p53 pathway activation in deficient embryos (↑3.5× p21 expression)

Research Findings from Mutagenesis

Table 2: Critical residues identified through alanine scanning

ResidueFunctionBinding LossActivity Loss
K74SAM coordination92%89%
L77Cap-binding pocket formation85%78%
W855'-5' triphosphate stabilization88%81%
T89RNA backbone interaction76%68%

Data derived from in vitro binding/activity assays

Comparative Analysis with CMTR1

Table 3: CMTR1 vs. CMTR2 functional divergence

ParameterCMTR1CMTR2
Methylation siteFirst nucleotide (cap0 → cap1)Second nucleotide (cap1 → cap2)
Cellular localizationNuclearCytoplasmic/nuclear
SAM dependenceAbsoluteConditional
Knockout phenotypeViable with immune defectsEmbryonic lethal

Sources:

Biomedical Implications

  • Therapeutic targeting: Structural differences from viral MTases (RMSD >3.2Å vs. SARS-CoV-2 nsp16) enable selective inhibitor design

  • Cancer relevance: CMTR2 mutations occur in 0.89% of human cancers (COSMIC database), though not yet classified as oncogenic

  • Developmental disorders: Murine endothelial-specific deletion causes defective angiogenesis (↓73% vascular branching)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CMTR2; AFT; FTSJD1; Cap-specific mRNA; nucleoside-2'-O--methyltransferase 2; Cap methyltransferase 2; Cap2 2'O-ribose methyltransferase 2; HMTr2; MTr2; FtsJ methyltransferase domain-containing protein 1; Protein adrift homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-770
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
CMTR2
Target Protein Sequence
MSKCRKTPVQQLASPASFSPDILADIFELFAKNFSYGKPLNNEWQLPDPSEIFTCDHTEL NAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHE ILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEA NDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQNFISSMATVHLVTADGSFDC QGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCFDQVHV FKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRH EECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAIQYFMQKFQLKHLSRNNWLV KKSSIGCSTNTKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS ILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPK QQYSCSCHVFSEELIFSELCSLTECLQDEQVVVPSNQIKCLLVGFSTLRNIKMHIPLEVR LLESAELTTFSCSLLHDGDPTYQRLFLDCLLHSLRELHTGDVMILPVLSCFTRFMAGLIF VLHSCFRFITFVCPTSSDPLRTCAVLLCVGYQDLPNPVFRYLQSVNELLSTLLNSDSPQQ VLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEIINSLQLQN
Uniprot No.

Target Background

Function
S-adenosyl-L-methionine-dependent methyltransferase that catalyzes mRNA cap2 2'-O-ribose methylation, modifying the 5'-cap structure of mRNAs. This enzyme methylates the ribose of the second nucleotide of a m(7)GpppG-capped mRNA and small nuclear RNA (snRNA) (cap0) to produce m(7)GpppRmpNm (cap2). It recognizes a guanosine cap on RNA regardless of its N(7) methylation status, exhibiting cap2 methylation on both cap0 and cap1 structures. It demonstrates a preference for cap1 RNAs.
Gene References Into Functions
  1. Crystal structures of the active CMTr2 catalytic domain in complex with a methyl group donor and a capped oligoribonucleotide provide insights into the mechanism of specific recognition of capped RNA. PMID: 24402442
  2. This report validates a human enzyme that methylates the ribose of the second transcribed nucleotide encoded by FTSJD1. PMID: 21310715
Database Links

HGNC: 25635

OMIM: 616190

KEGG: hsa:55783

STRING: 9606.ENSP00000337512

UniGene: Hs.72782

Subcellular Location
Nucleus. Cytoplasm.

Q&A

What is the primary function of CMTR2 in mRNA processing?

This 2'-O-methylation process (cOMe) is an important co-transcriptional modification that occurs in the nucleus and appears to be critical for proper mRNA processing and function. The methylation reaction is S-adenosylmethionine (SAM)-dependent, with CMTR2 using SAM as a methyl donor .

The modification introduced by CMTR2 contributes to the formation of what is known as the "cap2" structure in mRNAs. In humans, approximately half of capped and polyadenylated RNA molecules contain this cap2 methylation , suggesting specific regulatory roles rather than universal requirements for all mRNAs.

How does CMTR2 differ from CMTR1 in terms of target specificity?

CMTR2 demonstrates more selective target specificity compared to CMTR1, which shows broader activity across the transcriptome. Evidence from polytene chromosome staining in Drosophila revealed that while CMTr1 prominently co-localizes with RNA Polymerase II across many chromosomal regions, CMTr2 is only prominently localized to a subset of transcribed genes .

This target selectivity is further supported by CLIP (cross-linking and immunoprecipitation) experiments, which identified 3,109 genes as CMTr1 targets compared to only 762 genes for CMTr2 that were twofold or more enriched above input . When focusing on high-confidence targets (at least 3-fold enrichment), researchers identified 1,146 genes for CMTr1 compared to only 117 genes for CMTr2 .

What is the structural basis for CMTR2 function?

While high-resolution structures have been determined for the methyltransferase domain of human CMTr1 bound to a capped oligonucleotide and SAM, the structure of CMTR2 has primarily been developed through comparative modeling rather than direct crystallography .

The comparative model of the CMTr2 catalytic domain, based on the crystal structure of CMTr1, has revealed important insights into its mechanism, though it "is not sufficiently accurate to allow us to speculate about the atomic details of N1 recognition" . Both enzymes share common structural features including:

  • A core region composed of methyltransferase (MTase) and helical domains

  • Deep pockets for binding the cap and SAM

  • Conserved catalytic domains across species

De novo structural prediction using machine learning algorithms like RoseTTA has been applied to compare CMTr structures across model organisms, protists, and viruses . These analyses confirmed structural conservation of key domains while highlighting species-specific differences.

The binding mechanism appears to involve recognition of the 7-methylguanosine (m7G) cap structure, with structural studies of related cap methyltransferases showing that the m7G cap binds to a pocket formed by the MTase and helical domains .

What experimental approaches are most effective for studying CMTR2 activity in vitro?

Several complementary approaches have proven effective for studying CMTR2 activity:

Enzymatic Assays:

  • SAM-dependent methyltransferase assays using purified recombinant CMTR2 and synthetic capped RNA substrates

  • Preference analysis using substrates with different cap structures (m7GpppA vs. m7GpppAm) to assess substrate specificity

Structural Analysis:

  • Crystallography of CMTR2 complexed with cap analogs and SAM analogs

  • Comparative modeling based on related MTase structures

Binding Studies:

  • Analysis of CMTR2 interaction with the Ser5-phosphorylated C-terminal domain (CTD) of RNA polymerase II to understand co-transcriptional recruitment

  • Cross-linking experiments to identify protein-RNA interactions

The experimental data suggests that when studying CMTR2 activity, researchers should consider its preference for substrates with specific features. For example, it has been shown that CMTR2 preferentially N6-methylates m7GpppAm rather than m7GpppA, indicating the importance of the 2'-O-methyl group of the target site for efficient methylation .

How can researchers effectively measure changes in 2'-O-methylation status in mRNAs?

Measuring 2'-O-methylation status requires specialized techniques:

RNA-MS Analysis:

  • Mass spectrometry approaches have revealed that modifications like m6Am are more abundant (92%) in human mRNAs than previously estimated

  • This approach allows precise quantification of methylation levels

Novel Sensitive Assays:

  • Research mentions "a novel sensitive assay to analyse 2'-O-ribose methylation" , though specific details are not fully described in the search results

Mutant Analysis:

  • Generating knockout cell lines (e.g., CAPAM KO cells) where m6Am disappeared completely and converted to Am modification in mRNAs

  • Comparative analysis between wild-type and mutant samples

CLIP-seq Approaches:

  • Cross-linking and immunoprecipitation sequencing to identify targets of methyltransferases, as demonstrated in Drosophila studies

When analyzing 2'-O-methylation status, researchers should be aware that these modifications occur in a species- and tissue-specific manner , necessitating careful experimental design that accounts for biological context.

What are the phenotypic consequences of CMTR2 deficiency in model organisms?

Studies in Drosophila have provided valuable insights into the consequences of CMTR2 deficiency:

Learning and Memory:

  • Double-mutant flies lacking both CMTr1 and CMTr2 exhibit significant impairment in both immediate (3 min) and 24-hour memory in appetitive conditioning learning assays

  • Single mutants for either gene alone did not show significant memory deficits, suggesting functional redundancy

Neural Function:

  • The learning deficits could be rescued by conditional expression of CMTr2 in mushroom body neurons before training

  • This rescue effect demonstrates an acute role for CMTr2 in adult neurons rather than solely a developmental requirement

Stress Response:

  • CAPAM (responsible for N6-methylation of m6Am) knockout cells were viable but sensitive to oxidative stress, implying the physiological importance of related cap modifications

Synaptic Localization:

  • CMTr is required for localization of untranslated mRNAs to synapses

  • This function is similar to that of Fragile X Mental Retardation Protein (FMRP), suggesting a potential connection to neurological disorders

Embryonic Development:

  • CMTr2 has been reported to play a transient role in tracheal development

The viability of double-mutant flies lacking both CMTr1 and CMTr2 suggests that while these enzymes are important for optimal neurological function, they are not essential for survival .

How does CMTR2 activity affect translation efficiency?

The impact of CMTR2 on translation appears complex:

Translational Enhancement:

  • Ribosome profiling of CAPAM knockout cells showed that N6-methylation of m6Am promotes the translation of capped mRNAs

  • This suggests that cap modifications introduced by methyltransferases like CMTR2 may serve to enhance translation efficiency

Transcript Stability:

  • RNA-sequencing analysis of CAPAM knockout cells revealed that loss of m6Am does not significantly affect transcriptome alteration

  • This contradicts earlier proposals that m6Am functions in stabilizing A-starting capped mRNAs

Local Translation:

  • CMTr targets include many cell adhesion and signaling molecules that may require localized translation at synapses

  • The requirement for CMTr in localizing untranslated mRNAs to synapses suggests a role in facilitating local protein synthesis

Researchers investigating CMTR2's effects on translation should consider experimental approaches that distinguish between effects on global translation versus targeted enhancement of specific transcripts. The apparent contradiction between the lack of transcriptome alteration and enhanced translation efficiency suggests complex regulatory mechanisms that warrant further investigation.

What are the best approaches for generating CMTR2 knockout models?

Based on the research literature, several approaches have proven effective:

Genetic Knockout Models:

  • In Drosophila, researchers have successfully generated both single mutants for CMTr1 and CMTr2, as well as double-mutant flies

  • These models have been crucial for understanding the phenotypic consequences of CMTr deficiency

Conditional Expression Systems:

  • Gene-Switch (GS) systems driven by tissue-specific promoters (e.g., MB247-driven Gene-Switch) allow for conditional induction of CMTR2 expression by feeding flies with RU486

  • This approach enables temporal control of expression, which is crucial for distinguishing between developmental and acute roles

Epitope Tagging:

  • Researchers have used epitope-tagged genomic rescue constructs to study CMTR expression patterns and subcellular localization

  • This approach allows for visualization of protein localization through immunostaining

For researchers seeking to create CMTR2 knockout models, it's important to consider:

  • The potential for functional redundancy between CMTR1 and CMTR2

  • Tissue-specific effects that may require conditional knockout approaches

  • The need for careful validation of knockout efficiency

How can researchers identify and validate CMTR2 target transcripts?

Several complementary approaches have been employed:

CLIP (Cross-linking and Immunoprecipitation):

  • This technique has proven effective for identifying targets for both CMTR1 and CMTR2

  • In Drosophila studies, researchers identified 762 genes as CMTR2 targets that were twofold or more enriched above input

Polytene Chromosome Staining:

  • This approach revealed that while CMTR1 co-localizes broadly with RNA Pol II, CMTR2 localizes to only a subset of transcribed genes

  • This technique provides a visual confirmation of target specificity

Functional Classification of Targets:

  • Analysis of high-confidence CMTR2 targets (≥3-fold enriched) revealed enrichment for genes involved in cellular signaling, including ion channels, synaptic vesicle release, and cell adhesion

Validation Through Phenotypic Rescue:

  • Researchers have confirmed the relevance of specific targets by testing whether expression of CMTR2 in neurons known to express these targets can rescue phenotypic defects in knockout models

The table below summarizes key differences in target identification between CMTR1 and CMTR2:

FeatureCMTR1CMTR2
Total CLIP targets (≥2-fold enriched)3,109 genes762 genes
High-confidence targets (≥3-fold enriched)1,146 genes117 genes
Chromosomal localizationBroad, co-localizes with RNA Pol IIRestricted to subset of genes
Target expansion in absence of other CMTrNot testedDoes not expand in absence of CMTR1
Prominent target categoriesCell signaling, ion channelsSynaptic vesicle release, cell adhesion, ion channels

What factors should be considered when designing experiments to study CMTR2 in neuronal function?

Given the neuronal enrichment and learning phenotypes associated with CMTR2, researchers should consider:

Tissue-Specific Expression:

  • Both CMTR1 and CMTR2 show higher expression in larval brains and to some extent in the adult nervous system

  • CMTR2 also shows high expression in testis and trachea

Subcellular Localization:

  • CMTR2 shows both nuclear and cytoplasmic localization, with cytoplasmic expression more prominent than for CMTR1

  • This suggests potential roles beyond co-transcriptional modification

Neuronal Subtypes:

  • In Drosophila, restoration of CMTR2 expression in all mushroom body Kenyon cells (KCs) rescued learning defects, while expression in restricted KC subsets did not

  • This indicates the importance of targeting appropriate neuronal populations

Temporal Considerations:

  • The learning defect in Drosophila could be rescued by inducing CMTR2 expression just before training in adult flies

  • This suggests an acute role rather than solely a developmental requirement

Potential Mechanistic Links:

  • Many CMTR2 targets are also targets of Fragile X Mental Retardation Protein (FMRP)

  • Like FMRP, cOMe is required for localization of untranslated mRNAs to synapses

Researchers should design experiments that can distinguish between:

  • Developmental versus acute roles of CMTR2

  • Effects on global versus specific transcript populations

  • Direct effects on RNA processing versus indirect effects through altered gene expression

What are the most promising areas for future CMTR2 research?

Based on current knowledge gaps and recent findings, several research directions appear particularly promising:

Neurological Disorders:

  • Given the learning phenotypes in Drosophila and the overlap between CMTR2 targets and FMRP targets , investigating connections to intellectual disabilities and autism spectrum disorders

  • Exploring whether CMTR2 variants are associated with human neurological conditions

Mechanistic Understanding:

  • Determining the precise mechanism by which CMTR2 contributes to mRNA localization to synapses

  • Investigating how CMTR2-mediated modifications affect interactions with RNA-binding proteins

Stress Response:

  • Further investigating the observation that cells lacking related cap modifications are sensitive to oxidative stress

  • Exploring whether CMTR2 plays a role in cellular stress adaptation

Structural Biology:

  • Obtaining high-resolution structures of CMTR2 bound to substrate RNAs and SAM

  • Current models "not sufficiently accurate to allow us to speculate about the atomic details of N1 recognition"

Target Specificity:

  • Understanding what determines CMTR2's selective targeting of specific transcripts

  • Investigating whether this specificity changes under different cellular conditions or developmental stages

How might CMTR2 interact with other RNA modification pathways?

The research suggests several potential interactions:

Coordination with CMTR1:

  • While they have distinct primary targets (first versus second nucleotide), there appears to be functional redundancy in some contexts

  • In Drosophila, single mutants have minimal phenotypes while double mutants show learning defects

Interaction with Cap Binding Complex:

  • Like FMRP, cOMe enhances binding of the cap binding complex in the nucleus

  • This suggests potential coordination with cap-binding proteins

Relationship to CAPAM:

  • CAPAM catalyzes N6-methylation of m6Am in capped mRNAs

  • CAPAM preferentially N6-methylates m7GpppAm rather than m7GpppA, indicating the importance of the 2'-O-methyl group for efficient methylation

  • This suggests potential sequential or cooperative activity with CMTRs

RNA Polymerase II Connection:

  • CAPAM has a N-terminal WW domain that specifically interacts with the Ser5-phosphorylated C-terminal domain (CTD) of RNA polymerase II

  • This suggests co-transcriptional activity that may coordinate with other co-transcriptional RNA processing events

Researchers investigating these interactions should consider experimental approaches that can detect sequential or cooperative activities, such as analyzing the consequences of perturbing multiple pathways simultaneously.

What is the current consensus on CMTR2's biological significance?

Current research suggests that CMTR2 plays important roles in:

  • mRNA Processing: Through 2'-O-methylation of cap-adjacent nucleotides, particularly the second transcribed nucleotide .

  • Neuronal Function: Particularly in learning and memory, as demonstrated by reward learning defects in Drosophila CMTr double mutants .

  • mRNA Localization: Required for localization of untranslated mRNAs to synapses, similar to FMRP .

  • Translation Regulation: Related cap modifications promote the translation of capped mRNAs rather than affecting transcript stability .

The research consistently indicates that CMTR2 has more selective targeting than CMTR1, with particular enrichment for transcripts encoding proteins involved in synaptic function and cell adhesion . While not essential for viability, CMTR2 appears critical for optimal neurological function.

The requirement for CMTR2 in adult neurons before learning, rather than solely during development, suggests an ongoing role in maintaining neuronal plasticity . This places CMTR2 within the growing field of epitranscriptomics - RNA modifications that add a layer of regulation to gene expression beyond the primary sequence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.