Recombinant Human FUN14 domain-containing protein 1 (FUNDC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
FUNDC1; FUN14 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVT GWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS
Uniprot No.

Target Background

Function
Acts as an activator of hypoxia-induced mitophagy, a crucial mechanism for mitochondrial quality control.
Gene References Into Functions
  1. FUNDC1 serves as a prognostic biomarker in cervical cancer patients and a potential therapeutic target to enhance chemoradiotherapy efficacy. PMID: 28719148
  2. Tyrosine 18 phosphorylation of FUNDC1 acts as a molecular switch for mitophagy. PMID: 27653272
  3. FUNDC1 integrates mitochondrial fission and mitophagy at the endoplasmic reticulum-mitochondrial contact site, collaborating with DRP1 and calnexin under hypoxic conditions in mammalian cells. PMID: 27145933
  4. FUNDC1 regulates both mitochondrial fission/fusion and mitophagy. PMID: 27050458
  5. The BCL2L1-PGAM5-FUNDC1 axis is essential for receptor-mediated mitophagy. PMID: 25126723
  6. FUNDC1 regulates ULK1 recruitment to damaged mitochondria; ULK1-mediated FUNDC1 phosphorylation is crucial for mitophagy. PMID: 24671035
  7. FUNDC1 knockdown significantly inhibits hypoxia-induced mitophagy, a process reversed by wild-type FUNDC1 expression. PMID: 22267086
Database Links

HGNC: 28746

OMIM: 300871

KEGG: hsa:139341

STRING: 9606.ENSP00000367284

UniGene: Hs.7549

Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is FUNDC1 and where is it primarily expressed?

FUNDC1 is an integral mitochondrial outer-membrane protein that functions as a receptor for selective mitochondrial autophagy (mitophagy). It is primarily expressed in tissues with high energy demands such as the heart and skeletal muscles . As a mitophagy receptor, FUNDC1 is critical for maintaining mitochondrial quality and homeostasis, particularly under hypoxic conditions .

The protein contains a characteristic FUN14 domain and is strategically positioned in the outer mitochondrial membrane where it can interact with autophagy machinery components, enabling it to serve as a bridge between damaged mitochondria and the autophagy apparatus .

What are the key structural features and domains of FUNDC1?

FUNDC1 contains a FUN14 domain which is essential for its function in mitophagy. Its structure includes:

  • A recombinant fragment protein within Human FUN14 domain-containing protein 1 between amino acids 1-100 that serves as an immunogen for antibody production

  • Specific phosphorylation sites that regulate its activity, including the K70 site which interacts with OPA1 (a protein involved in mitochondrial fusion)

  • Domains that facilitate interaction with LC3 family proteins, which is critical for mitophagy initiation

  • Regions that enable binding to DRP1 (dynamin-related protein 1), a key mediator of mitochondrial fission

These structural features allow FUNDC1 to function effectively as a mitophagy receptor and participate in various mitochondria-related processes.

What are the primary cellular functions of FUNDC1?

FUNDC1 serves multiple critical roles in cellular processes:

FunctionMechanismPhysiological Significance
Mitophagy ReceptorInteracts with and recruits LC3 protein family to mitochondriaMaintains mitochondrial quality and homeostasis
Mitochondrial FissionRecruits DRP1 at ER-mitochondria contact sitesFacilitates mitochondrial division during hypoxia
ER-Mitochondria CommunicationMediates formation of mitochondria-associated ER membranes (MAMs)Enables organelle crosstalk and calcium signaling
Angiogenesis RegulationInterferes with Ca²⁺ communication and regulates VEGFR2 expressionPromotes blood vessel formation
NeuroprotectionInduces mitophagy and improves mitochondrial functionProtects against neuronal loss after spinal cord injury
Ferroptosis RegulationInteracts with GPX4 to facilitate its mitochondrial recruitmentInfluences hepatic ferroptosis
Unfolded Protein ResponseParticipates in clearance of unfolded proteinsMaintains mitochondrial proteostasis
Iron MetabolismContributes to iron handling in mitochondriaSupports mitochondrial metabolic functions

This multifunctionality highlights FUNDC1's importance beyond mitophagy, positioning it as a central player in mitochondrial and cellular homeostasis.

How is FUNDC1 regulated under normal and stress conditions?

FUNDC1 undergoes complex regulation that differs between normal physiological conditions and cellular stress:

Under Normal Conditions:

  • FUNDC1 is maintained in a phosphorylated state, which keeps its mitophagy receptor function inactive

  • It interacts with OPA1 (a mitochondrial fusion protein) at the K70 site

  • Its levels are controlled through ubiquitination by E3 ubiquitin ligase MARCH5, which targets it for degradation

Under Hypoxic/Stress Conditions:

  • FUNDC1 expression initially increases, peaking after approximately 6 hours of oxygen-glucose deprivation in experimental models

  • OPA1 is cleaved or degraded by YME1L and OMA1 under mitochondrial stress, causing FUNDC1 and OPA1 to separate

  • FUNDC1 becomes dephosphorylated, activating its mitophagy receptor function

  • Dephosphorylated FUNDC1 recruits DRP1 to mitochondria, promoting fission—a prerequisite for mitophagy

  • The deubiquitinase USP19 stabilizes FUNDC1 at MAMs, enhancing its activity in mitochondrial quality control

This dynamic regulation allows FUNDC1 to respond appropriately to cellular stress and initiate protective mechanisms when needed.

How does FUNDC1-mediated mitophagy differ from other mitophagy pathways?

FUNDC1 represents a distinct mitophagy pathway with several unique characteristics:

FeatureFUNDC1-Mediated MitophagyPINK1/Parkin-Mediated MitophagyBNIP3L/NIX-Mediated Mitophagy
Primary TriggerHypoxia/ischemia Mitochondrial membrane depolarizationHypoxia/development
MechanismDirect LC3 binding after dephosphorylation Ubiquitination of outer membrane proteinsDirect LC3 binding
RegulationPhosphorylation/dephosphorylation switch Ubiquitination cascadeBH3 domain interactions
Additional FunctionsMitochondrial fission, ER-mitochondria communication Quality controlDevelopmental mitophagy
Disease RelevanceIschemic injuries, cardiovascular diseases Parkinson's diseaseErythrocyte maturation

The hypoxia-specific nature of FUNDC1-mediated mitophagy makes it particularly relevant for studying and treating ischemic conditions like myocardial infarction, stroke, and spinal cord injury . Unlike other pathways, FUNDC1 appears to integrate mitophagy with mitochondrial dynamics and interorganelle communication, providing a comprehensive response to hypoxic stress .

What role does FUNDC1 play in mitochondrial dynamics?

FUNDC1 serves as a critical regulator of mitochondrial dynamics, particularly fission, which is essential for mitophagy:

  • Interaction with Fusion Machinery: Under normal conditions, FUNDC1 interacts with OPA1 (a key mediator of mitochondrial fusion) at the K70 site, maintaining normal mitochondrial morphology .

  • Promotion of Fission Under Stress: During hypoxia or mitochondrial stress:

    • OPA1 is cleaved by YME1L and OMA1, causing FUNDC1 to separate from OPA1

    • Dephosphorylated FUNDC1 recruits DRP1 (dynamin-related protein 1) to mitochondria

    • This recruitment promotes DRP1 oligomerization and GTPase activity, driving mitochondrial fission

    • The deubiquitinase USP19 stabilizes FUNDC1 at MAMs, enhancing its ability to recruit DRP1

  • Coordination with Mitophagy: The FUNDC1-mediated fission creates smaller mitochondrial fragments that can be more efficiently engulfed by autophagosomes, facilitating mitophagy .

  • Pathological Significance: In models of spinal cord injury, FUNDC1 overexpression enhances both mitochondrial fission and subsequent mitophagy, reducing neuronal apoptosis and improving functional outcomes .

This integrated role in both fission and mitophagy positions FUNDC1 as a master regulator of mitochondrial quality control under stress conditions.

How does FUNDC1 function at ER-mitochondria contact sites?

FUNDC1 plays a crucial role at mitochondria-associated ER membranes (MAMs), the specialized contact sites between endoplasmic reticulum and mitochondria:

  • MAMs Formation and Maintenance: FUNDC1 mediates the formation of MAMs, which serve as important signaling hubs and sites for lipid transfer between the two organelles .

  • Calcium Signaling: At these contact sites, FUNDC1 influences intracellular Ca²⁺ communication, which affects processes like:

    • Mitochondrial metabolism and bioenergetics

    • Apoptotic signaling

    • Angiogenesis through regulation of VEGFR2 expression

  • Coordination of Mitochondrial Fission:

    • Under hypoxic conditions, FUNDC1 may interact with calnexin (an ER protein) and subsequently dissociate

    • The deubiquitinase USP19 stabilizes FUNDC1 at MAMs

    • FUNDC1 recruits DRP1 to these contact sites, facilitating mitochondrial fission at specific ER-mitochondria junctions

  • Integration with Mitophagy: The positioning of FUNDC1 at MAMs allows for coordinated mitochondrial fission and subsequent mitophagy, ensuring efficient removal of damaged mitochondrial segments .

  • Pathological Relevance: Disruption of FUNDC1's function at MAMs may contribute to various pathologies including cardiovascular diseases and ischemic injuries .

This multifaceted role at ER-mitochondria contact sites highlights FUNDC1's importance beyond simple mitophagy, revealing its integrated function in cellular homeostasis and stress responses.

How does phosphorylation regulate FUNDC1 activity?

The phosphorylation status of FUNDC1 serves as a molecular switch that regulates its activity in mitophagy and related processes:

Phosphorylation StateCellular ConditionFunctional ConsequenceRegulatory Mechanisms
PhosphorylatedNormal/BasalInactive mitophagy receptor; maintains interaction with OPA1 Constitutive kinase activity
DephosphorylatedHypoxia/StressActivated mitophagy receptor; enhanced LC3 binding; recruitment of DRP1 Phosphatase activation or kinase inhibition under stress

Specific phosphorylation sites have been identified, including:

  • The K70 site that regulates interaction with OPA1 under normal conditions

  • Sites that affect FUNDC1's ability to bind LC3 and initiate mitophagy

The phosphorylation regulation of FUNDC1 has significant implications:

  • It allows for rapid response to hypoxic stress without requiring new protein synthesis

  • It coordinates mitochondrial dynamics with mitophagy through regulated interactions with OPA1 and DRP1

  • In cardiovascular disorders, altered FUNDC1 phosphorylation states correlate with disease progression and outcomes

  • Targeting the enzymes that control FUNDC1 phosphorylation could provide therapeutic opportunities for modulating mitophagy in disease contexts

This phosphorylation-based regulation represents a sophisticated control mechanism that allows cells to fine-tune mitochondrial quality control in response to varying levels of stress.

What protein-protein interactions are critical for FUNDC1 function?

FUNDC1 engages in multiple protein-protein interactions that are essential for its diverse cellular functions:

Key FUNDC1 Interaction Partners and Functional Significance:

Interaction PartnerInteraction ContextFunctional OutcomeDetection Method
LC3 Family ProteinsActivated during hypoxia after FUNDC1 dephosphorylationMitophagy initiation and progressionCo-IP, immunofluorescence co-localization
DRP1/DNM1LRecruited to mitochondria during stressMitochondrial fission promotionImmunofluorescence, mitochondrial morphology analysis
OPA1Interaction at K70 under normal conditionsMaintenance of mitochondrial fusion; inhibition of inappropriate mitophagyMutational analysis, co-IP
GPX4Direct interaction in liver cellsFacilitation of GPX4 recruitment to mitochondria; regulation of ferroptosisProtein proximity assays, functional ferroptosis assays
CalnexinInteraction and dissociation under hypoxiaRegulation at ER-mitochondria contact sitesSubcellular fractionation, MAMs isolation
USP19Interaction at MAMsDeubiquitination and stabilization of FUNDC1Ubiquitination assays, protein stability measurements

Methodological Approaches for Studying These Interactions:

  • Imaging-Based Methods:

    • Immunofluorescence co-localization with quantification of yellow puncta (co-localization) relative to total puncta per cell

    • FRET (Fluorescence Resonance Energy Transfer) for detecting direct interactions in living cells

    • Super-resolution microscopy for detailed visualization of interaction sites

  • Biochemical Approaches:

    • Co-immunoprecipitation under various conditions (normal, hypoxic)

    • Proximity ligation assay (PLA) for detecting endogenous protein interactions

    • Pull-down assays using recombinant proteins to map interaction domains

  • Dynamic Interaction Analysis:

    • Live-cell imaging with fluorescently tagged proteins

    • Time-course experiments during hypoxia/OGD to track temporal dynamics

    • FLIM (Fluorescence Lifetime Imaging Microscopy) for quantitative interaction measurements

  • Domain Mapping and Mutagenesis:

    • Site-directed mutagenesis of key residues (e.g., K70 for OPA1 interaction)

    • Truncation constructs to identify minimal interaction domains

    • Competition assays with peptides corresponding to interaction interfaces

Understanding these protein-protein interactions provides crucial insights into FUNDC1's regulatory mechanisms and helps identify potential targets for therapeutic intervention in diseases involving mitochondrial dysfunction.

What is the role of FUNDC1 in disease models and potential therapeutic applications?

FUNDC1 has demonstrated significant roles in various disease models, suggesting potential therapeutic applications:

Spinal Cord Injury (SCI):

FUNDC1 overexpression provides neuroprotection through multiple mechanisms:

  • Enhanced neuronal autophagy and decreased neuronal apoptosis in the early stage of injury

  • Inhibition of mitochondria-dependent apoptosis through mitophagy

  • Improved mitochondrial function and reduced oxidative damage

  • Protection against neuronal loss and promotion of functional recovery

These findings suggest FUNDC1 activation as a potential early intervention strategy for SCI patients.

Cardiovascular Diseases:

Disease StateFUNDC1 RolePotential Therapeutic ApproachEvidence
Myocardial ischemia/reperfusionProtective through mitophagy enhancementFUNDC1 activation or overexpressionPhosphorylation state correlates with disease progression
Heart failureMitochondrial quality controlPrevention of mitochondrial dysfunctionLoss of FUNDC1 leads to fragmentation and failure to repair infarcted hearts
Cardiac progenitor cell differentiationFacilitation of mitochondrial homeostasisEnhancement of cardiac regenerationFUNDC1 supports differentiation and repair processes

Renal Disorders:

  • FUNDC1 modulation improves both renal anemia and renal fibrosis

  • Suggests applications in chronic kidney disease and acute kidney injury

Cancer:

  • FUNDC1 is associated with cancer progression, though specific mechanisms require further investigation

  • May represent a novel target for cancer therapy by modulating mitochondrial dynamics and function

Therapeutic Approaches and Considerations:

  • Gene Therapy:

    • AAV-mediated FUNDC1 delivery has shown efficacy in SCI models

    • Potential for targeted delivery to affected tissues in acute ischemic conditions

  • Small Molecule Development:

    • Compounds targeting FUNDC1's phosphorylation state

    • Modulators of FUNDC1's interaction with key partners (LC3, DRP1)

    • Stabilizers of FUNDC1 protein to enhance its protective functions

  • Timing Considerations:

    • Early intervention appears critical, particularly in acute ischemic injuries

    • Therapeutic window may differ between acute (SCI, stroke) and chronic conditions

  • Potential Side Effects:

    • Excessive mitophagy could deplete necessary mitochondria in unaffected tissues

    • Disruption of normal mitochondrial dynamics might impact energy production

    • Tissue-specific approaches may be necessary to avoid systemic effects

The multifaceted protective role of FUNDC1 in various disease models, particularly ischemic injuries, positions it as a promising therapeutic target for conditions characterized by mitochondrial dysfunction and cellular stress.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.