Recombinant Human FXYD domain-containing ion transport regulator 4 (FXYD4)

What is the molecular structure and basic characterization of human FXYD4?

FXYD4 is a small membrane protein with a molecular weight of approximately 9.2 kDa, belonging to the FXYD family characterized by a 35-amino acid signature sequence beginning with PFXYD. It is a single-pass type I membrane protein with its N-terminus on the extracellular side and C-terminus on the cytoplasmic side. The protein contains 89 amino acids with the sequence: MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQHSPVPEKAIPLITPGSATTC . FXYD4 was originally named CHIF (channel-inducing factor) and is encoded by the FXYD4 gene located at chromosome 10q11.21 . The protein's extracellular FXYD motif is crucial for its biological function, particularly in its interactions with the Na, K-ATPase .

How does FXYD4 expression vary across different tissues?

FXYD4 demonstrates highly tissue-specific expression patterns, with prominent expression in the distal colon and the medullary collecting duct of the kidney . This distinct localization corresponds to its specialized function in electrolyte transport regulation. Unlike some other FXYD family members with broader distribution patterns, FXYD4's restricted expression suggests a specialized role in aldosterone-responsive tissues responsible for maintaining body Na+ and K+ homeostasis . Researchers investigating FXYD4 should consider these tissue-specific patterns when designing experiments to assess its physiological function or when selecting appropriate cell models.

What methodologies can differentiate FXYD4 from other FXYD family members?

When investigating FXYD4 specifically among other family members, researchers should employ:

• Isoform-specific antibodies: Develop antibodies targeting the unique C-terminal region of FXYD4 that differs from other family members.

• RT-qPCR with validated primers: Design primers that target unique regions of FXYD4 mRNA not conserved in other family members.

• Tissue-specific analysis: Focus on distal colon and renal medullary collecting duct tissues where FXYD4 is prominently expressed compared to other FXYD proteins .

• Functional discrimination: FXYD4 uniquely decreases the apparent affinity for intracellular Na+ of Na, K-ATPase, while increasing affinity for extracellular Na+, opposite to the effects of some other FXYD proteins .

• Protein-protein interaction assays: Use co-immunoprecipitation to detect specific FXYD4-Na,K-ATPase interactions, which have distinct characteristics compared to other FXYD-ATPase interactions.

What expression systems yield optimal recombinant human FXYD4 protein for experimental studies?

For optimal recombinant human FXYD4 protein production, the HEK293T mammalian expression system has demonstrated notable success. This system provides appropriate post-translational modifications and protein folding essential for maintaining FXYD4's functional characteristics . The expression protocol typically involves:

• Transfection with validated cDNA clone: Use of human FXYD4 cDNA clone transfected into HEK293T cells .

• Protein extraction and purification: Capturing recombinant protein through anti-tag (e.g., DDK) affinity columns followed by conventional chromatography steps .

• Quality assessment: Verification through SDS-PAGE and Coomassie blue staining to ensure purity greater than 80% .

• Buffer optimization: For maximum stability, recombinant FXYD4 performs best in 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol .

For experimental applications, it's recommended to filter the protein preparation before cell culture applications, though researchers should account for some protein loss during filtration .

How should researchers design experiments to study FXYD4's effects on Na,K-ATPase activity?

To effectively investigate FXYD4's modulatory effects on Na,K-ATPase activity, consider these methodological approaches:

• Membrane preparation: Isolate membrane fractions from tissues or cells expressing both FXYD4 and Na,K-ATPase.

• ATPase activity assays: Measure Na,K-ATPase activity through ATP hydrolysis rates using colorimetric phosphate detection methods under varying Na+ and K+ concentrations.

• Ion affinity analysis: Determine Na+ and K+ affinity changes by measuring enzyme activity across concentration gradients, comparing FXYD4-associated and non-associated Na,K-ATPase.

• Co-immunoprecipitation: Confirm physical association between FXYD4 and Na,K-ATPase α-subunit.

• Electrophysiological measurements: Apply patch-clamp techniques to measure ion transport in cells with manipulated FXYD4 expression.

• Controls and validation: Include both positive controls (known Na,K-ATPase modulators) and negative controls (other FXYD family members) to confirm specificity of FXYD4 effects.

The experimental design should account for FXYD4's unique ability to increase Na+ affinity of Na,K-ATPase, which permits efficient Na+ reabsorption even at low intracellular Na+ concentrations, particularly important in aldosterone-responsive tissues .

What analytical methods best characterize FXYD4-Na,K-ATPase interaction sites?

To characterize the structural and functional interaction sites between FXYD4 and Na,K-ATPase, researchers should employ multiple complementary approaches:

• Site-directed mutagenesis: Systematically mutate residues in both FXYD4 and Na,K-ATPase to identify critical interaction points.

• Cross-linking studies: Use chemical cross-linkers followed by mass spectrometry to identify residues in close proximity.

• Co-crystallization: Attempt X-ray crystallography of the FXYD4-Na,K-ATPase complex to determine atomic-level interactions.

• Molecular dynamics simulations: In silico modeling of binding dynamics based on known structures.

• FRET/BRET analysis: Measure protein-protein interactions in living cells using fluorescence or bioluminescence resonance energy transfer.

• Peptide competition assays: Use synthetic peptides derived from FXYD4 sequences to competitively inhibit interaction with Na,K-ATPase.

Research has shown that the transmembrane domain of FXYD4 interacts with specific regions of the Na,K-ATPase, affecting ion transport properties and modulating the apparent affinity for extracellular Na+ . This interaction appears to be mediated through specific structural domains that can be targeted for detailed analysis.

How is FXYD4 expression altered in colon cancer and what is its prognostic significance?

FXYD4 demonstrates significant expression changes in colon cancer with important clinical implications:

• Differential expression: FXYD4 is significantly overexpressed in colon cancer samples compared to matched normal tissues .

• Gender correlation: The expression of FXYD4 was significantly related to gender in colon cancer patients, suggesting potential sex-specific regulatory mechanisms .

• Prognostic value: Multivariate analysis identified FXYD4 as an independent prognostic factor for cancer recurrence with a hazard ratio of 1.673 (95% CI: 1.160-2.413, P=0.006) .

• Pathway involvement: High expression of FXYD4 in colon cancer was positively related to "oxidative phosphorylation" and "citrate cycle" pathways, while negatively related to "T cell receptor signaling pathway" and "adhesion molecule CAMs" . This suggests FXYD4 may influence cancer progression through metabolic reprogramming and immune modulation.

Researchers studying FXYD4 in cancer contexts should incorporate gender-stratified analyses and consider examining relationships between FXYD4 expression and metabolic pathway alterations in experimental models.

What molecular mechanisms underlie FXYD4's altered expression in cancer?

The aberrant expression of FXYD4 in cancerous tissues appears to be regulated through multiple mechanisms:

• Epigenetic regulation: DNA methylation analysis revealed that expression of FXYD family members, including FXYD4, is negatively associated with methylation levels in their promoter regions . This suggests that hypomethylation may contribute to FXYD4 overexpression in colon cancer.

• Transcriptional regulation: Altered transcription factor activity in cancer cells likely contributes to differential FXYD4 expression.

• Pathway interaction: FXYD4's involvement in oxidative phosphorylation and citrate cycle pathways suggests it may play a role in the metabolic reprogramming characteristic of cancer cells .

• Protein-protein interaction network: FXYD4 shows correlation with other FXYD family members and strong interaction with Na+/K+-ATPase subunits, suggesting coordinated regulation within a functional network .

Researchers investigating the oncogenic role of FXYD4 should consider these regulatory mechanisms when designing experiments to target or modulate its expression in cancer models.

How does FXYD4 function affect renal physiology in disease models?

FXYD4's specialized function in renal physiology makes it an important factor in kidney-related disorders:

• Na+ and K+ homeostasis: FXYD4 plays a crucial role in aldosterone-responsive tissues responsible for maintaining body Na+ and K+ homeostasis . Its interaction with Na,K-ATPase modifies the pump's properties to permit efficient Na+ reabsorption even at low intracellular Na+ concentrations.

• Medullary collecting duct function: FXYD4's prominent expression in the medullary collecting duct suggests specific involvement in fine-tuning sodium reabsorption in this nephron segment .

• Response to hormonal stimuli: As an aldosterone-responsive protein, FXYD4 likely mediates some of the adaptive responses of the kidney to hormonal regulation of electrolyte balance.

• Experimental approaches: Researchers studying FXYD4 in renal physiology should consider:

  • Using kidney-specific FXYD4 knockout or overexpression models

  • Examining responses to aldosterone stimulation and electrolyte challenges

  • Measuring transepithelial ion transport in isolated tubule preparations

  • Quantifying Na+ and K+ handling in response to physiological stressors

Understanding FXYD4's role in renal physiology could provide insights into disorders of electrolyte handling and potentially identify new therapeutic targets for conditions like hypertension or electrolyte imbalances.

How can researchers investigate the role of FXYD4 in oxidative phosphorylation and metabolic regulation?

To investigate FXYD4's involvement in cellular metabolism, particularly oxidative phosphorylation and the citrate cycle, researchers should implement these methodological approaches:

• Metabolic flux analysis: Use isotope-labeled substrates (13C-glucose, 13C-glutamine) to track metabolic pathway activities in cells with manipulated FXYD4 expression.

• Mitochondrial function assays: Measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using platforms like Seahorse XF Analyzer in FXYD4-overexpressing or knockout cells.

• Activity assays for key enzymes: Quantify the activities of rate-limiting enzymes in the citrate cycle and electron transport chain components.

• Mitochondrial membrane potential: Assess changes in mitochondrial membrane potential using fluorescent probes like TMRM or JC-1 in response to FXYD4 manipulation.

• ATP production measurement: Quantify cellular ATP levels and production rates under various metabolic conditions.

• Metabolomic profiling: Perform comprehensive metabolomic analysis to identify altered metabolite levels in pathways positively correlated with FXYD4 expression.

Gene set enrichment analysis has revealed that high expression of FXYD4 is positively related to "oxidative phosphorylation" and "citrate cycle" pathways , suggesting a potential role in cellular energy metabolism that extends beyond its canonical function as an ion transport regulator.

What techniques can reveal the relationship between FXYD4 and immune response pathways?

To investigate FXYD4's negative relationship with T cell receptor signaling and adhesion molecule pathways , researchers should consider these experimental approaches:

• Co-culture systems: Establish co-culture models of immune cells with FXYD4-manipulated epithelial or cancer cells to assess immune cell activity and infiltration.

• Flow cytometry analysis: Quantify changes in immune cell populations and activation markers in response to FXYD4 expression alterations.

• Cytokine profiling: Measure secreted cytokines and chemokines in FXYD4-modified environments using multiplexed immunoassays.

• T cell activation assays: Assess T cell receptor signaling pathway activation through phosphorylation of downstream signaling molecules (ZAP-70, LAT, NFAT) in the presence of FXYD4-expressing cells.

• Adhesion assays: Quantify immune cell adhesion to FXYD4-manipulated cells under static and flow conditions.

• Transcriptional analysis: Perform RNA-seq or targeted gene expression analysis focusing on immune-related genes in response to FXYD4 modulation.

The negative correlation between FXYD4 expression and T cell receptor signaling pathway suggests that FXYD4 may contribute to immune evasion mechanisms in cancer contexts , an area ripe for further investigation to potentially identify novel immunotherapeutic strategies.

What methodologies best assess FXYD4's tissue-specific functions across different physiological states?

To comprehensively evaluate FXYD4's tissue-specific functions across varying physiological conditions, researchers should implement these approaches:

• Conditional tissue-specific knockout models: Generate animal models with inducible, tissue-specific FXYD4 deletion to study organ-specific functions.

• Physiological challenge studies: Expose animals or cell models to conditions that alter electrolyte balance (high/low sodium diets, dehydration, acid-base disturbances) and assess FXYD4-dependent responses.

• Ex vivo tissue preparations: Use isolated, perfused kidney or colon preparations from normal and FXYD4-manipulated animals to measure ion transport under controlled conditions.

• Hormonal response analysis: Examine FXYD4 expression and function in response to aldosterone, vasopressin, and other hormones that regulate electrolyte homeostasis.

• Single-cell transcriptomics: Apply single-cell RNA sequencing to identify cell-specific expression patterns of FXYD4 and co-expressed genes in complex tissues.

• In situ functional imaging: Develop fluorescent sensors for Na+ or K+ transport to visualize FXYD4-dependent ion movements in live tissues.

FXYD4's prominent expression in specific segments of the kidney and colon suggests evolved tissue-specific functions that may vary according to physiological demands for electrolyte handling and transport . Understanding these specialized roles requires experimental designs that can capture the dynamic nature of FXYD4 function across different physiological states.

How can FXYD4's prognostic value in cancer be developed into clinical applications?

To translate FXYD4's identified prognostic significance in colon cancer into clinical applications, researchers should pursue these methodological approaches:

• Biomarker validation studies: Conduct large-scale, multi-center retrospective and prospective studies to validate FXYD4 expression as a prognostic biomarker across diverse patient populations.

• Development of diagnostic assays: Standardize immunohistochemistry or RT-qPCR protocols for reliable clinical measurement of FXYD4 expression in patient samples.

• Combination biomarker panels: Investigate whether FXYD4 expression provides additional prognostic value when combined with established biomarkers and clinicopathological parameters.

• Therapeutic targeting strategies: Explore whether inhibiting FXYD4 function or expression affects cancer cell survival, metabolism, or treatment response in preclinical models.

• Patient stratification algorithms: Develop computational models incorporating FXYD4 expression data to stratify patients for personalized treatment approaches.

The independent prognostic value of FXYD4 for cancer recurrence (HR=1.673, P=0.006) provides a strong rationale for its potential clinical utility, particularly when integrated with other established risk factors.

What experimental approaches can identify potential FXYD4 inhibitors for therapeutic development?

For researchers interested in developing FXYD4-targeted therapeutics, consider these methodological approaches:

• High-throughput screening: Develop cell-based assays measuring Na,K-ATPase activity modulated by FXYD4 to screen compound libraries for potential inhibitors.

• Structure-based drug design: Utilize computational modeling of FXYD4-Na,K-ATPase interactions to design small molecules that disrupt this protein-protein interaction.

• Peptide mimetics: Design peptides based on the interaction domains between FXYD4 and Na,K-ATPase that could competitively inhibit their association.

• Antisense oligonucleotides: Develop sequence-specific oligonucleotides targeting FXYD4 mRNA to reduce expression in tissues where it contributes to pathology.

• Antibody-based approaches: Generate antibodies targeting the extracellular domain of FXYD4 that could interfere with its function or mediate its removal from the cell surface.

• Functional validation: Assess candidate inhibitors for their effects on:

  • Na,K-ATPase activity

  • Cellular ion homeostasis

  • Metabolic pathways (oxidative phosphorylation, citrate cycle)

  • Cancer cell proliferation and survival

  • Immune cell interactions

The development of selective FXYD4 modulators could provide valuable research tools and potentially lead to novel therapeutic approaches for conditions where FXYD4 dysregulation contributes to pathology.