Recombinant Human G protein-activated inward rectifier potassium channel 3 (KCNJ9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNJ9; GIRK3; G protein-activated inward rectifier potassium channel 3; GIRK-3; Inward rectifier K(+ channel Kir3.3; Potassium channel, inwardly rectifying subfamily J member 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Uniprot No.

Target Background

Function

This G protein-regulated receptor belongs to the inward rectifier potassium channel family. These channels exhibit a preference for potassium influx over efflux. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel activation voltage to more positive potentials. Inward rectification is primarily attributed to intracellular magnesium block of outward current.

Gene References Into Functions
  1. A pivotal role for this neuronal potassium channel in regulating NCAM-dependent neurite outgrowth is established, highlighting the functional interplay of Kir3.3, NCAM, and TrkB in development. PMID: 20610389
  2. The GRIK3 (T928G) genotype frequencies in schizophrenia patients were comparable to those in their relatives. PMID: 19995671
Database Links

HGNC: 6270

OMIM: 600932

KEGG: hsa:3765

STRING: 9606.ENSP00000357067

UniGene: Hs.66726

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ9 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is KCNJ9 and what cellular functions does it mediate?

KCNJ9 is the gene encoding G protein-activated inward rectifier potassium channel 3 (GIRK3), a subunit of G protein-coupled inwardly rectifying potassium (GIRK) channels. These channels function as key determinants of cellular excitability, particularly in neurons and cardiac cells. GIRK channels are uniquely regulated by different receptor classes: they are activated by receptors coupling to Gαi/o proteins and inhibited by those coupling to Gαq proteins . This dual regulation mechanism allows GIRK channels to act as molecular switches that respond to various neurotransmitters and hormones.

The GIRK3 subunit (encoded by KCNJ9) typically assembles with other GIRK subunits to form heterotetrameric channels, with GIRK2/GIRK3 being a common configuration. These channels mediate slow inhibitory postsynaptic potentials by increasing potassium conductance, which hyperpolarizes the membrane potential and reduces neuronal excitability. The proper functioning of these channels depends on the correct assembly of the tetramer structure, and disruptions in this process may lead to neurological disorders .

How does GIRK3 differ structurally and functionally from other GIRK family members?

While all GIRK channels share basic structural features including two transmembrane domains and a pore-forming region, GIRK3 (encoded by KCNJ9) possesses unique structural characteristics that differentiate it from other family members. Unlike GIRK1, GIRK2, and GIRK4, which can form functional homomeric channels or heteromeric complexes, GIRK3 typically does not form functional homomeric channels but instead preferentially assembles into heteromeric channels with other GIRK subunits, particularly GIRK2.

What are the expression patterns of KCNJ9 across different tissues and developmental stages?

KCNJ9 demonstrates a tissue-specific expression pattern with predominant expression in the nervous system, particularly in brain regions involved in cognitive functions, reward processing, and pain perception. Within the central nervous system, KCNJ9 expression is notable in the hippocampus, cerebral cortex, amygdala, and certain brainstem nuclei. Lower levels of expression have been detected in the cardiovascular system, digestive system, and endocrine glands.

During development, KCNJ9 expression follows a temporally regulated pattern, with expression beginning during embryonic stages and continuing into adulthood. The mouse gene detail for Kcnj9 indicates its expression across multiple developmental stages and tissue types, including embryonic ectoderm, nervous system, cardiovascular system, and endocrine system . This developmental regulation suggests important roles for KCNJ9 in neuronal maturation and circuit formation.

What are the optimal expression systems for producing functional recombinant human KCNJ9 for electrophysiological studies?

For effective electrophysiological studies of recombinant human KCNJ9, researchers should consider several expression systems, each with distinct advantages. Mammalian cell lines (particularly HEK293 and CHO cells) represent the gold standard for GIRK channel expression as they provide appropriate post-translational modifications and contain many of the signaling components necessary for channel regulation. When using these systems, co-transfection with other GIRK subunits (especially GIRK2) is crucial since GIRK3 alone typically does not form functional channels.

The optimal transfection protocol involves using lipofection methods with a DNA ratio favoring GIRK3:GIRK2 at approximately 1:1. Including a reporter gene (such as GFP) on a separate plasmid at 10% of the total DNA improves identification of successfully transfected cells. For stable cell lines, antibiotic selection with G418 is recommended, followed by cell sorting to isolate populations with consistent expression levels. Importantly, expression should be verified through both Western blotting and immunofluorescence to confirm proper protein production and membrane localization.

For patch-clamp recordings, cells should be studied 48-72 hours post-transfection when protein expression reaches optimal levels. The recording solution should contain physiological K+ concentrations (typically 5 mM external, 140 mM internal), and channel activation is best achieved using either direct Gβγ application or through co-expressed G protein-coupled receptors like the μ-opioid or GABA-B receptors .

How can researchers effectively design experiments to study GIRK3 interactions with different Gβγ subunits?

When designing experiments to study GIRK3 interactions with different Gβγ subunits, researchers should employ multiple complementary approaches. Based on established protocols, a comprehensive experimental design should include:

First, in vitro binding assays using purified recombinant proteins represent a fundamental approach. GST-fusion proteins containing N- and C-terminal cytoplasmic domains of GIRK3 can be immobilized on glutathione agarose beads and incubated with purified Gβγ dimers containing various β subunits (β1-β5) paired with different γ subunits (γ2, γ11, etc.). This approach successfully demonstrated that β3γ2, β4γ2, and β1γ2 bind directly to cytoplasmic domains of GIRK channels .

Second, functional measurements through electrophysiological approaches are essential to determine if binding translates to functional effects. Cell lines expressing GIRK3 with another GIRK subunit (typically GIRK1 or GIRK2) should be transfected with different combinations of Gβ and Gγ subunits. Patch-clamp recordings can then measure basal and agonist-induced currents. This approach revealed that while β1, β3, and β4 containing dimers activated GIRK channels, β5-containing dimers inhibited channel currents in a dose-dependent manner consistent with competitive inhibition .

Third, co-immunoprecipitation experiments using differentially tagged GIRK3 and Gβγ subunits can verify complex formation in cellular contexts. Finally, for more advanced investigation, FRET or BRET approaches can evaluate real-time dynamics of these interactions in living cells.

What protein purification strategies yield the highest quality recombinant KCNJ9 protein?

Obtaining high-quality recombinant KCNJ9 protein requires specialized purification strategies due to its hydrophobic transmembrane domains and complex folding requirements. The most successful purification approach involves a two-step expression system beginning with bacterial expression of soluble cytoplasmic domains for binding studies, followed by mammalian cell expression for full-length protein.

For cytoplasmic domains, E. coli BL21(DE3) transformation with a pGEX vector containing GST-fused N- or C-terminal KCNJ9 domains yields good expression levels. Induction should be performed at 16°C with 0.1-0.5 mM IPTG for 16-18 hours to reduce inclusion body formation. Purification using glutathione-agarose affinity chromatography followed by size exclusion chromatography produces pure protein suitable for binding studies with Gβγ subunits .

For full-length KCNJ9, mammalian expression in HEK293S GnTI- cells (glycosylation-deficient) improves protein homogeneity. The protein should include a cleavable affinity tag (His8 or FLAG) and be extracted using a buffer containing 1% digitonin or 1% DDM with cholesterol hemisuccinate. Purification requires a multi-step approach including metal affinity chromatography, tag cleavage, and size exclusion chromatography. The final buffer should contain a mixture of lipids (POPC/POPE/cholesterol at 3:1:1 ratio) to maintain protein stability. This protocol typically yields 0.5-1 mg of purified protein per liter of mammalian cell culture, with purity >90% as assessed by SDS-PAGE and preserved function confirmed by reconstitution into liposomes for flux assays.

How do specific mutations in KCNJ9 alter channel function, and what experimental approaches best characterize these effects?

Mutations in KCNJ9 can significantly alter channel function through various mechanisms including altered gating kinetics, modified ion selectivity, disrupted subunit assembly, or changed interaction with regulatory proteins. The recent identification of a de novo variant in KCNJ9 (p.Phe326Ser) associated with neonatal seizures provides an important case study of how mutations can affect channel function .

To comprehensively characterize mutational effects, researchers should employ a multi-faceted experimental approach. First, electrophysiological characterization using patch-clamp techniques in heterologous expression systems allows direct measurement of channel conductance, gating properties, and response to modulators. For the p.Phe326Ser variant, whole-cell patch-clamp recordings revealed altered channel kinetics and responsiveness to G protein signaling.

Second, biochemical approaches should assess protein expression, stability, and trafficking. Western blotting with subcellular fractionation and surface biotinylation assays can determine if the mutation affects membrane targeting. Third, co-immunoprecipitation experiments can evaluate if the mutation disrupts interactions with other GIRK subunits or regulatory proteins.

Fourth, structural modeling provides mechanistic insights. For the p.Phe326Ser variant, three-dimensional modeling predicted disruption of hydrophobic contacts with valine side chains, potentially destabilizing neighboring structures and undermining GIRK2/GIRK3 tetramer formation . Finally, functional studies in neuronal cultures or animal models can assess the physiological impact of mutations, connecting molecular alterations to cellular and systemic phenotypes.

What are the controversies surrounding the role of KCNJ9 in neuropathic pain and addiction mechanisms?

The involvement of KCNJ9 in neuropathic pain and addiction mechanisms represents an area of significant research interest but remains controversial due to conflicting data and challenges in isolating GIRK3-specific effects. One fundamental controversy centers on whether GIRK3 subunits primarily function to inhibit GIRK signaling by forming channels with altered properties or reduced surface expression, or whether they contribute unique signaling capabilities to heteromeric channels.

In addiction research, while some studies suggest that KCNJ9 knockout mice show altered responses to opioids and reduced self-administration of cocaine, others report minimal phenotypic changes compared to knockouts of other GIRK subunits. This discrepancy may reflect complex compensatory mechanisms or brain region-specific effects that are difficult to disentangle with global knockout approaches.

For neuropathic pain, evidence suggests GIRK3-containing channels modulate spinal cord pain processing, but contradictory findings exist regarding whether GIRK3 upregulation or downregulation contributes to hyperalgesia. Some researchers propose that GIRK3 has distinct roles in different pain modalities or that its effects are dependent on the specific heteromeric composition of GIRK channels in different neuronal populations.

These controversies highlight the need for more sophisticated research approaches, including conditional and cell-type-specific genetic manipulations, combined with advanced electrophysiological techniques and behavioral assessments. Region-specific viral-mediated gene transfer or CRISPR-based approaches may help resolve these contradictions by allowing more precise spatial and temporal control over KCNJ9 expression.

How can structural modeling approaches predict the functional consequences of KCNJ9 variants?

Structural modeling approaches have become invaluable for predicting functional consequences of KCNJ9 variants, particularly given challenges in obtaining experimental structures of membrane proteins. The recent case of the p.Phe326Ser variant demonstrates how these approaches can provide mechanistic insights into pathogenicity .

A comprehensive structural modeling workflow begins with sequence alignment to identify suitable templates. Close homologs of human GIRK3 with known structures serve as templates for building initial models. For KCNJ9, researchers have utilized tools like BLASTP to identify structural homologs and HHpred/Modeller to construct reliable structural models . When no suitable homolog is available, newer approaches like AlphaFold can generate ab initio predictions, though some protein regions may remain poorly resolved.

Once a baseline structural model is established, researchers can introduce specific variants and simulate their effects through molecular dynamics (MD) simulations. For the p.Phe326Ser variant, modeling predicted disruption of hydrophobic contacts that could destabilize neighboring structures and potentially undermine tetramer formation . These predictions can guide experimental designs by highlighting residues for mutagenesis or specific structural elements to probe.

To validate structural predictions, researchers should correlate modeling results with experimental data from electrophysiology, protein stability assays, and interaction studies. This integrated approach connecting computational predictions with experimental validation provides the most robust framework for understanding how specific KCNJ9 variants affect channel function at the molecular level.

What evidence supports the role of KCNJ9 variants in neurological disorders?

Emerging evidence increasingly supports the role of KCNJ9 variants in neurological disorders, with the most compelling data coming from recent genetic studies of seizure disorders. A breakthrough case report identified a de novo variant in the KCNJ9 gene (p.Phe326Ser) in a newborn presenting with convulsive syndrome on the third day of life . This variant was predicted to be pathogenic by multiple computational tools (PolyPhen-2: 0.653, Sift: 0.0, CADD: 26.3, REVEL: 0.632) and was absent from control populations in gnomAD .

The functional significance of this finding is supported by the observation that the KCNJ9 gene is depleted in missense variants (Z = 4.22, o/e = 0.26), suggesting evolutionary constraints against variation in this gene . Three-dimensional modeling of the variant indicated that the Phe326Ser change likely disrupts hydrophobic contacts with valine side chains, potentially destabilizing neighboring structures and undermining the formation of GIRK2/GIRK3 tetramers necessary for proper channel function .

Beyond seizure disorders, genetic association studies have implicated KCNJ9 in other neurological and psychiatric conditions, though these associations often lack the mechanistic clarity of the seizure-related variant. Mouse models with Kcnj9 alterations display neurological phenotypes including altered response to pain stimuli and changes in learning behaviors , providing further support for KCNJ9's role in neurological function and dysfunction.

How can researchers design functional assays to evaluate potential therapeutic modulators of KCNJ9?

Designing functional assays to evaluate potential therapeutic modulators of KCNJ9 requires a multi-tiered approach that progresses from high-throughput screening to detailed mechanistic studies. An effective screening cascade should begin with cell-based assays measuring channel activity.

The primary screening platform should utilize cell lines stably expressing GIRK3 with either GIRK1 or GIRK2 (since GIRK3 typically forms heteromeric channels) and employ fluorescence-based readouts of channel activity. Specifically, membrane potential-sensitive dyes or thallium flux assays (where Tl+ permeates through K+ channels) coupled with fluorescence plate readers enable high-throughput identification of compounds that modulate channel function. These assays should include positive controls such as known GIRK activators (e.g., naringin) or inhibitors (e.g., tertiapin-Q).

Hit compounds should then progress to patch-clamp electrophysiology for detailed characterization. Automated patch-clamp systems can maintain reasonable throughput while providing detailed information about activation/inactivation kinetics and voltage-dependence. For compounds showing promising activity profiles, selectivity should be assessed against other K+ channels, including related GIRKs and more distant K+ channel families.

For mechanistic understanding, binding assays using purified proteins can determine if compounds interact directly with GIRK3 or alter its interactions with Gβγ subunits. Finally, leads should be tested in neuronal cultures and animal models relevant to the targeted indication, with behavioral, electrophysiological, and biochemical readouts to assess efficacy and mechanism in more complex systems.

What are the challenges in translating KCNJ9 research findings from animal models to human applications?

Translating KCNJ9 research findings from animal models to human applications faces several significant challenges that researchers must address through careful experimental design and interpretation. First, species differences in KCNJ9 expression patterns and channel properties represent a fundamental challenge. While mouse Kcnj9 shows similar tissue distribution to human KCNJ9, subtle differences in expression levels across brain regions may lead to distinct functional roles. Additionally, sequence variations between species may affect channel properties and interactions with regulatory proteins or potential therapeutic compounds.

Second, the heteromeric nature of functional GIRK channels complicates translation. GIRK3 (encoded by KCNJ9) typically assembles with other GIRK subunits, and the specific combinations may differ between species or even between brain regions within the same species. Consequently, phenotypes observed in Kcnj9 knockout mice may not directly translate to human KCNJ9 dysfunction due to differences in compensatory mechanisms or channel composition.

Third, the complexity of GIRK channel regulation presents challenges for therapeutic development. GIRK channels are modulated by various G protein-coupled receptors, different Gβγ subunit combinations, phosphorylation, and lipid interactions. This multifaceted regulation means that compounds showing efficacy in simplified model systems may fail in more complex physiological contexts where multiple regulatory pathways operate simultaneously.

Finally, the lack of validated biomarkers for KCNJ9 function in humans presents a significant translational hurdle. While electrophysiological recordings can directly measure channel function in animal models, non-invasive measures applicable to human clinical studies remain limited. Developing imaging ligands, electroencephalographic signatures, or other biomarkers that reliably reflect KCNJ9 function would greatly facilitate translation of findings from preclinical models to human applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.