Recombinant Human G-protein coupled receptor 12 (GPR12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please communicate them to us, and we will prioritize the development of the specified tag.
Synonyms
GPR12; G-protein coupled receptor 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISC ENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWN CLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV
Uniprot No.

Target Background

Function
Promotes neurite outgrowth and blocks myelin inhibition in neurons. Receptor with constitutive G(s) signaling activity that stimulates cyclic AMP production.
Gene References Into Functions
  1. Our research indicates that CBD acts as an inverse agonist for GPR12. This finding provides a novel mechanism of action for CBD and serves as an initial chemical scaffold for developing highly potent and efficacious agents targeting GPR12, with the ultimate goal of inhibiting cancer metastasis. PMID: 28888984
  2. GPR12 may play a role in cell proliferation and survival. PMID: 22430950
  3. GPR12 regulates gene expression in vascular endothelial cells in the presence of fluid shear stress and is classified as a sphingosine 1-phosphate receptor. PMID: 12649592
Database Links

HGNC: 4466

OMIM: 600752

KEGG: hsa:2835

STRING: 9606.ENSP00000370844

UniGene: Hs.123034

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural relationship between GPR12 and other receptors?

GPR12 belongs to the rhodopsin (class A) receptors family and shares approximately 35% identity in the transmembrane regions with cannabinoid receptors (CB1 and CB2). It has a higher amino acid sequence identity with GPR3 and GPR6, ranging from 60-68% in transmembrane regions, and approximately 45% identity with lysophospholipid LPA1 and sphingosine-1-phosphate receptors . These structural similarities provide important context for understanding potential functional overlaps and evolutionary relationships between these receptors in experimental design.

Is GPR12 considered a cannabinoid receptor?

Although GPR12 was initially suggested to be a cannabinoid receptor due to its genetic relationship with CB1 and CB2 receptors, it does not meet the five criteria proposed in 2010 by the International Union of Basic and Clinical Pharmacology (IUPHAR) for classification as a cannabinoid receptor . When designing experiments to test ligand interactions, researchers should note this distinction while still considering potential cross-reactivity with cannabinoid-related compounds in binding studies.

What are the known endogenous and exogenous ligands for GPR12?

GPR12 appears to be endogenously activated by the lysophospholipids sphingosine-1-phosphate (S1P) and sphingosyl-phosphorylcholine (SPC), with SPC demonstrating a hundred times higher potency and efficacy compared to S1P . Exogenously, the phytocannabinoid cannabidiol (CBD) has been identified as a target for GPR12 . When conducting receptor binding or functional assays, researchers should consider using these ligands as positive controls and establish appropriate concentration ranges based on their documented potencies.

How does GPR12 function as a constitutively active receptor?

GPR12 exhibits constitutive activity by stimulating adenylate cyclase in the absence of ligand-receptor interaction. It upregulates the adenylate cyclase signaling cascade without any activating ligand, resulting in elevated basal levels of cyclic adenosine monophosphate (cAMP) . This constitutive activity should be accounted for in experimental design by including appropriate baseline controls when measuring signaling responses.

Which G protein coupling mechanisms are associated with GPR12?

GPR12 demonstrates dual coupling capacity, interacting with both Gαs and Gαi proteins. It stimulates baseline cAMP-dependent signaling by activating Gαs proteins while also inhibiting forskolin-activated signaling through Gαi interaction . Additionally, GPR12 mediates calcium release through a Gαi signaling cascade that partly involves the activation of intracellular sphingosine kinase . When investigating GPR12 signaling, researchers should employ multiple readout assays to capture these diverse signaling pathways.

How do external lipids influence GPR12 activity?

Research indicates that GPR12 activity depends on external lipids. When HEK293 cells overexpressing GPR12 were cultured in lipid-free medium, there was a decrease in basal cAMP production compared to cells grown in standard medium . This finding suggests that experimental conditions, particularly the lipid composition of culture media, can significantly impact GPR12 activity measurements. Researchers should carefully control and document media composition in GPR12 functional studies.

What is the tissue distribution pattern of GPR12?

GPR12 is primarily expressed in the brain, similar to the cannabinoid receptor CB1 . In embryonal mouse brain, strong expression of GPR12 has been detected in the cortical plate, piriform cortex, and hippocampus, with evident signals also found in the dorsomedial and arched nuclei, and weaker expression in the mamillary body . When designing experiments to study GPR12 function in specific tissues, these expression patterns should guide tissue selection and potentially inform the physiological relevance of findings.

How does GPR12 expression change during neuronal development?

GPR12 expression is upregulated in neuronal differentiation regions, whereas it is absent in neuroblast proliferation areas such as the ventricular zone . This differential expression pattern suggests developmental regulation of GPR12 and potential roles in neuronal maturation. Researchers studying neurodevelopmental processes should consider examining GPR12 expression at different developmental timepoints to correlate with specific neurodevelopmental events.

Is GPR12 expression altered in pathological conditions?

GPR12 has been found to be highly expressed in epithelial ovarian cancer (EOC) tissues across all four pathological types, and this high expression level correlates with poor prognosis in patients with EOC . When studying GPR12 in disease contexts, researchers should compare expression levels between normal and pathological tissues, and consider correlating expression levels with clinical outcomes to establish potential prognostic value.

What role does GPR12 play in neuronal differentiation and maturation?

Evidence suggests that sphingosyl-phosphorylcholine (SPC), a high-affinity ligand for GPR12, increases the number of synaptic contacts and synaptophysin expression in embryonic cerebral cortical neurons . Furthermore, SPC stimulates proliferation and cell clustering in mouse hippocampal HT22 cells, suggesting that SPC, possibly through interaction with GPR12, positively affects differentiation and maturation of postmitotic neurons . Researchers investigating neuronal differentiation should consider GPR12 as a potential target for promoting these processes.

How might GPR12 be involved in axonal regeneration?

Studies indicate that upregulated GPR12 expression could facilitate axonal regeneration in rat cerebellar granule neurons through its constitutive action, which increases intraneuronal cAMP, promoting neurite outgrowth and blocking myelin inhibition in rat primary neurons . Similar results were reported using rat pheochromocytoma PC12 cells, where GPR12 overexpression induced neuronal differentiation . When designing experiments to study neural regeneration, researchers might consider GPR12 modulation as a potential therapeutic approach and include cAMP measurements to elucidate the mechanism.

What are the current limitations in our understanding of GPR12's role in cognitive functions?

While GPR12 is expressed in brain regions related to cognition, including the hippocampus and cortex, its relationship with specific cognitive functions remains to be fully characterized . This represents a significant gap in our understanding of GPR12 biology. Future research should aim to correlate GPR12 expression or activity with cognitive outcomes using behavioral models, potentially employing GPR12 knockout or knockdown approaches to establish causal relationships.

How does GPR12 affect cancer cell survival and apoptosis?

Research demonstrates that GPR12 promotes cancer cell survival by inhibiting apoptosis. Knockdown of GPR12 in epithelial ovarian cancer (EOC) cells significantly reduces cell viability by inducing apoptosis, as evidenced by increased expression of BAX and cleaved caspase-3 . When investigating GPR12 in cancer contexts, researchers should employ multiple complementary approaches to assess apoptosis, including protein markers, flow cytometry, and functional assays.

What signaling pathways mediate GPR12's anti-apoptotic effects in cancer cells?

The extracellular signal-regulated kinase 1/2 (ERK1/2) pathway appears to be a critical mediator of GPR12's anti-apoptotic effects in cancer cells. GPR12 knockdown significantly reduces phosphorylation levels of ERK1/2 in EOC cells, while GPR12 overexpression increases ERK1/2 phosphorylation . Importantly, pretreatment with LM22B-10, a selective activator of ERK1/2, attenuates the decreased cellular viability and enhanced apoptosis induced by GPR12 knockdown . Researchers should include pathway inhibitors and activators in experimental designs to establish causal relationships between receptor activation and downstream effects.

How can GPR12 function be studied in tumor models in vivo?

A subcutaneous tumor xenograft model in nude mice has been successfully employed to study GPR12 function in vivo. In this model, cancer cells with GPR12 knockdown or control vectors are implanted subcutaneously, and tumor volume, weight, and apoptosis are evaluated . The following table summarizes key findings from such experiments:

ParameterControl GroupGPR12 Knockdown GroupSignificance
Tumor volumeHigherSignificantly decreasedp<0.05
Tumor weightHigherSignificantly decreasedp<0.05
Necrotic area (HE staining)LowerSignificantly increasedp<0.05
Apoptotic cells (TUNEL staining)FewerSignificantly increasedp<0.05
Cleaved caspase-3 expressionLowerSignificantly increasedp<0.05
Phosphorylated ERK1/2 levelsHigherSignificantly decreasedp<0.05

These findings demonstrate that GPR12 knockdown leads to tumor regression of EOC by inducing apoptosis, potentially through decreased ERK1/2 activation . Researchers designing in vivo studies should incorporate multiple endpoints to comprehensively assess the impact of GPR12 modulation on tumor biology.

What approaches are effective for modulating GPR12 expression in cellular models?

Both overexpression and knockdown approaches have been successfully employed to study GPR12 function. For overexpression, GPR12 DNA fragments can be inserted into appropriate expression vectors, such as pSin-EF2-Nanog-Pur plasmid with the Nanog gene replaced by GPR12 . For knockdown, short hairpin RNA (shRNA) for human GPR12 can be cloned into lentiviral vectors . Stable cell lines can be established through lentivirus infection followed by puromycin selection, with overexpression/knockdown efficiency evaluated by Western blot . Researchers should verify target specificity and establish appropriate controls for each genetic manipulation approach.

How can GPR12-mediated signaling be assessed in experimental systems?

Multiple approaches have been used to assess GPR12-mediated signaling:

  • cAMP measurements to evaluate Gαs coupling

  • Inhibition of forskolin-stimulated cAMP to assess Gαi coupling

  • Calcium mobilization assays to examine Gαi-mediated calcium release

  • Western blot analysis of phosphorylated ERK1/2 to assess downstream pathway activation

  • Expression analysis of apoptosis markers like BAX and cleaved caspase-3

When designing signaling studies, researchers should employ multiple, complementary assays to build a comprehensive understanding of GPR12 signaling in their specific experimental context.

What are the challenges in identifying specific ligands for GPR12?

Despite being cloned more than two decades ago, GPR12 remains classified as an orphan receptor without definitively confirmed endogenous ligands . While SPC and S1P have been proposed as potential endogenous activators, and CBD as an exogenous target, comprehensive pharmacological characterization remains incomplete . Researchers aiming to identify novel GPR12 ligands should employ multiple functional assays (cAMP, calcium, ERK1/2 phosphorylation) and include appropriate positive and negative controls. Additionally, computational approaches like molecular docking could help identify potential binding sites and predict ligand interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.