Recombinant Human G-protein coupled receptor 143 (GPR143)

Shipped with Ice Packs
In Stock

Description

Introduction to G-protein Coupled Receptor 143

G-protein coupled receptor 143 (GPR143) is encoded by the ocular albinism 1 (OA1) gene and was first identified through its association with X-linked ocular albinism, a disorder affecting pigment-producing cells . Unlike most GPCRs that function at the cell surface, GPR143 represents one of the few intracellular GPCRs, predominantly localizing to endolysosomes and melanosomes rather than the plasma membrane . This unusual localization pattern distinguishes GPR143 from conventional members of the GPCR superfamily and presents unique challenges for studying its function and identifying potential ligands.

GPR143 plays a critical role in regulating melanosome biogenesis and organelle size in pigment-producing cells, including melanocytes and retinal pigment epithelium (RPE) . Mutations in the GPR143 gene that disrupt normal protein function result in ocular albinism type 1 (OA1), characterized by hypopigmentation of the eyes and severe reduction in visual acuity due to disrupted visual system development . Despite its clinical importance, GPR143 remains classified as an orphan GPCR (oGPCR), with uncertainty surrounding its endogenous ligands and complete signaling pathways .

The deorphanization of GPR143 presents significant opportunities for understanding pigment cell biology and developing therapeutic approaches for pigmentation disorders and related conditions. Recombinant production of human GPR143 serves as a critical tool for advancing this research agenda by providing purified protein for structural and functional analyses .

Post-translational Modifications

GPR143 contains two potential N-glycosylation sites: one in the first extracellular loop (ECL1) at position N106 and another in the third extracellular loop (ECL3) . Experimental evidence has confirmed glycosylation at the N106 position, though the functional significance of this modification remains to be fully elucidated . The receptor also undergoes ubiquitination, which appears to be dependent on components of the endosomal sorting complexes required for transport (ESCRT) machinery .

Expression Systems

The production of recombinant human GPR143 typically employs mammalian expression systems due to the complex nature of the protein and requirements for proper folding and post-translational modifications . Human embryonic kidney (HEK-293) cells represent a preferred expression system for recombinant GPR143 production, offering advantages for intracellular, secreted, and transmembrane proteins .

Chinese hamster ovary (CHO) cells have also been utilized for expression of GPR143 in functional studies, particularly when coupled with reporter systems such as β-arrestin recruitment assays . These cells are advantageous for studying GPR143 function as they express very few endogenous GPCRs, are easily transfected, and are compatible with multiple cell-based assay systems .

Purification and Characterization

Recombinant GPR143 can be purified using affinity chromatography, typically facilitated by the addition of epitope tags such as polyhistidine (His) tags . These tags enable one-step purification processes while minimally impacting protein function. Purification quality assessment typically employs methods such as SDS-PAGE and Western blotting, with commercially available recombinant preparations achieving purity levels exceeding 90% .

Modified GPR143 Variants for Research

For functional studies, researchers have developed modified versions of GPR143 to overcome challenges associated with its intracellular localization. A notable example is the plasma membrane-targeted GPR143 (pm-GPR143), which contains mutations in the intracellular sorting signals (L223A-L224A, W329A-E330A) . This variant localizes to the plasma membrane with the putative binding site facing the extracellular space, making it accessible to potential ligands in the culture medium while maintaining functional properties similar to the wild-type receptor .

This strategic modification has proven valuable for high-throughput screening approaches to identify compounds that interact with GPR143, as demonstrated in studies utilizing β-arrestin recruitment assays .

Constitutive Activity

A distinctive characteristic of GPR143 is its high constitutive activity in signaling assays, particularly in β-arrestin recruitment systems . This baseline activity occurs in the absence of exogenous ligands, suggesting that GPR143 may function through ligand-independent mechanisms or respond to endogenous compounds that remain to be fully characterized .

Signaling Mechanisms

GPR143 appears to signal through multiple pathways typical of GPCRs, including interactions with G proteins and β-arrestin . The receptor has been shown to recruit β-arrestin, a process exploited in screening assays to identify potential modulators of receptor activity . This interaction suggests involvement of canonical GPCR signaling mechanisms despite the receptor's atypical localization.

The specific G protein coupling preferences of GPR143 remain incompletely characterized, though its designation as a GPCR implies signal transduction through heterotrimeric G proteins. The receptor's intracellular localization suggests that it may interact with G proteins in endosomal or melanosomal membranes rather than at the plasma membrane, representing an unconventional signaling arrangement .

Known Inhibitors and Modulators

Recent screening efforts have identified several compounds that modulate GPR143 activity, particularly focusing on inhibitors that reduce its constitutive activity. Three validated inhibitors—pimozide, niclosamide, and ethacridine lactate—have been shown to reduce GPR143 activity in β-arrestin recruitment assays . These compounds also demonstrate effects on melanocyte pigmentation and expression of tyrosinase, a key melanogenic enzyme, suggesting that they act as functional modulators of GPR143-mediated pathways .

Role in Pigment Cell Biology

GPR143 plays a critical role in the biogenesis and maturation of melanosomes, the specialized organelles where melanin pigment is synthesized and stored . The receptor regulates melanosome size, number, and maturation, with mutations leading to the formation of macromelanosomes and altered pigmentation patterns .

In melanocytes and retinal pigment epithelium cells, GPR143 influences melanin production pathways, potentially through regulation of key enzymes such as tyrosinase . The identification of GPR143 inhibitors that reduce tyrosinase expression supports this regulatory connection and provides tools for manipulating pigmentation pathways experimentally .

Expression Pattern and Tissue Distribution

While GPR143 is most prominently expressed in pigment-producing cells, including melanocytes and retinal pigment epithelium, emerging evidence suggests broader expression patterns in other tissues . The Human Protein Atlas reports expression of GPR143 in brain tissues, though the functional significance of this expression remains to be fully explored .

Expression data for GPR143 across various brain structures has been reported, though detailed quantitative information about expression levels across different tissues and cell types is still being compiled . This broader expression pattern suggests potential roles for GPR143 beyond pigment cell biology, opening new avenues for investigation.

Role in Ocular Albinism Type 1

Mutations in the GPR143 gene are the primary cause of X-linked ocular albinism type 1 (OA1, also known as Nettleship-Falls ocular albinism) . This condition is characterized by severe reduction in visual acuity, hypopigmentation of the eyes, nystagmus, and other visual system abnormalities .

The pathophysiology of OA1 involves both developmental and functional defects in the visual system, including abnormalities in retinal pigment epithelium, altered melanin production, and defects in optic nerve crossing at the chiasm . These manifestations highlight the importance of GPR143 in normal visual system development and function.

Screening Platforms for Drug Discovery

Recombinant GPR143 has been instrumental in developing screening platforms for identifying compounds that modulate receptor activity . The β-arrestin recruitment assay, particularly when coupled with the plasma membrane-targeted GPR143 variant, provides a powerful tool for high-throughput screening of compound libraries .

This approach has successfully identified several GPR143 inhibitors from diverse chemical libraries, including the Tocris library (containing biologically active compounds that modulate GPCRs, ion channels, kinases, enzymes, and transporters) and an in-house drug library containing approximately 600 marketed drugs . These screening efforts have yielded valuable pharmacological tools for investigating GPR143 function and potential therapeutic leads .

Development of Therapeutic Approaches

The identification of compounds that modulate GPR143 activity creates opportunities for developing therapeutic approaches for conditions involving pigmentation abnormalities, particularly ocular albinism . Pharmacological agents that restore or mimic GPR143 function could potentially address aspects of OA1 or related conditions.

Furthermore, understanding GPR143 signaling pathways may reveal additional therapeutic targets within these pathways that could be modulated to achieve beneficial effects in pigmentation disorders or other conditions where GPR143 plays a role .

Deorphanization Efforts

As an orphan GPCR, GPR143 presents continuing challenges in identifying its endogenous ligands and fully characterizing its signaling pathways . Ongoing efforts to deorphanize this receptor may benefit from the recombinant protein tools and screening platforms that have been developed, potentially leading to identification of natural ligands or more potent synthetic modulators .

The unusual intracellular localization of GPR143 suggests that its ligands may include compounds present in the lumen of melanosomes or lysosomes, such as melanin precursors or other intracellular metabolites . This hypothesis requires further investigation and may necessitate specialized screening approaches.

Therapeutic Development Challenges

Developing therapies targeting GPR143 presents unique challenges due to its intracellular localization, which may limit accessibility to potential therapeutic agents . Strategies to overcome this barrier might include development of cell-permeable compounds or alternative approaches targeting downstream effectors of GPR143 signaling .

Additionally, the timing of GPR143's role in development, particularly in the visual system, may create windows of therapeutic opportunity that require intervention during specific developmental periods . Understanding these temporal aspects will be crucial for effective therapeutic strategies.

Expansion of Functional Understanding

While the role of GPR143 in pigment cells is well-established, its potential functions in other tissues, such as the brain, remain largely unexplored . Expanding our understanding of GPR143 expression patterns and functions across different tissues and cell types may reveal new physiological roles and therapeutic opportunities .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please specify them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that tag.
Synonyms
GPR143; OA1; G-protein coupled receptor 143; Ocular albinism type 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
GPR143
Target Protein Sequence
MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSP ATSPPASVRILRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSA MWIQLLYSACFWWLFCYAVDAYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPS VSRCERGLDHAIPHYVTMYLPLLLVLVANPILFQKTVTAVASLLKGRQGIYTENERRMGA VIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGSLKPVRTAAKTTWFIMGILNP AQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVG GQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL
Uniprot No.

Target Background

Function
GPR143 is a receptor for tyrosine, L-DOPA, and dopamine. Upon binding to L-DOPA, it stimulates Ca(2+) influx into the cytoplasm, increases secretion of the neurotrophic factor SERPINF1, and relocalizes beta arrestin at the plasma membrane. This ligand-dependent signaling occurs through a G(q)-mediated pathway in melanocytic cells. Its activity is mediated by G proteins that activate the phosphoinositide signaling pathway. GPR143 also plays a role as an intracellular G protein-coupled receptor involved in melanosome biogenesis, organization, and transport.
Gene References Into Functions
  1. Three novel mutations, c.333_360+14del42insCTT, c.276G>A (p.W92X), and c.793C>T (p.R265X), were identified in GPR143 by PCR followed by Sanger sequencing in members of families with X-linked ocular albinism. PMID: 28211458
  2. The findings of this study expanded the gene mutation spectrum of GPR143 and investigated the clinical phenotype of patients with OA1 in the Chinese population. PMID: 28339057
  3. The c.758T>A mutation in exon 6 of the GPR143 gene is associated with X-linked ocular albinism. PMID: 28397224
  4. Our results expand the spectrum of GPR143 mutations causing CN and further confirm the role of GPR143 in the pathogenesis of CN. PMID: 27958203
  5. Identifying tyrosinase as a potential GPR143 binding protein opens new avenues for investigating the mechanisms that regulate pigmentation and neurogenesis. PMID: 27720922
  6. X-linked ocular albinism type I, characterized by developmental eye defects, results from GPR143 mutations. PMID: 28632878
  7. This family was found to harbor a novel, likely pathogenic mutation in GPR143, resulting in a combined Stargart disease and heterozygous carrier phenotype in the affected sisters. PMID: 27367509
  8. Here, we report a Chinese trio-family with the son affected by X-linked ocular albinism, where a novel missense mutation in GPR143 was observed. PMID: 26547501
  9. Twenty Chinese patients, including 15 sporadic IN cases and 5 from X-linked IN families, were recruited and underwent molecular genetic analysis. PCR-based DNA sequencing of the entire coding region and the splice junctions of the FRMD7 and GPR143 genes was performed in participants. PMID: 27036142
  10. Downstream signaling from GPR143 controls RPE secretion of pigment epithelium-derived factor (PEDF), a potent neurotrophic and antiangiogenic factor. PMID: 26741053
  11. Five mutations in the GPR143 gene were detected in each of the five families, including a novel nonsense mutation of c.333G>A, two novel splicing mutations of c.360+1G>C and c.659-1G>A, and a novel small deletion mutation of c.43_50dupGACGCAGC. PMID: 26160353
  12. An intronic mutation that creates a cryptic splice-donor site in GPR143 of patients with ocular albinism. PMID: 26061757
  13. The GPR143 gene analysis identified an identical point mutation in two Ocular albinism 1 patients and their mothers. PMID: 24526317
  14. Melanosome-autonomous regulation of size and number: the OA1 receptor sustains PMEL expression. PMID: 24650003
  15. OA1 is involved in melanoma cell migration, and OA1-induced melanoma cell migration is mediated through the RAS/RAF/MEK/ERK signaling pathway. PMID: 24736838
  16. A novel splicing site mutation of the GPR143 gene was found in a Han Chinese congenital ocular albinism pedigree. PMID: 24301936
  17. Data report that the p.Y269X mutation of the GPR143 gene is responsible for the pathogenesis of familial ocular albinism. PMID: 22916221
  18. Four patients with X-linked ocular albinism type 1 were identified from a cohort of 15 boys with clinical signs of albinism using mutation detection methods. PMID: 22486324
  19. These results identify the Oa1 transducer Galphai3 as the first downstream component in the Oa1 signaling pathway. PMID: 21931697
  20. The ocular albinism type 1 (OA1) GPCR is ubiquitinated, and its traffic requires endosomal sorting complex responsible for transport (ESCRT) function. PMID: 21730137
  21. TYR gene mutations have a more severe effect on pigmentation than mutations in OCA2 and the GPR143 gene. However, mutations in these genes affect the development of visual function either directly or by interaction with other genes like MC1R. PMID: 21541274
  22. A novel causative mutation of GPR143 was identified in a five-generation Chinese family with X-linked ocular albinism. PMID: 21423867
  23. TYR gene mutations represent a relevant cause of oculocutaneous albinism in Italy, whereas mutations in P present a lower frequency. Clinical analysis revealed that the severity of the ocular manifestations depends on the degree of retinal pigmentation. PMID: 20861488
  24. This is the first report of a Japanese X-linked ocular albinism (XLOA) patient with a GPR143 mutation. PMID: 21348135
  25. L-DOPA activates GPR143 signaling through a Gq pathway, while dopamine inhibits the receptor. PMID: 18828673
  26. We describe the first Spanish family known to present with X-linked ocular albinism due to mutations in the OA1 gene. PMID: 20649618
  27. OA1 interacts with MART-1 at early stages of melanogenesis to control melanosome identity and composition. PMID: 19717472
  28. Review: mutational analysis in ocular albinism type 1. PMID: 11793467
  29. OA1 has been immunologically characterized as an antigen that is expressed, processed, and presented in an MHC-restricted fashion by melanoma cells, but for which there is the human equivalent of a "knockout"--i.e., complete deletion in a male patient. PMID: 12538723
  30. Mutations in the OA1 gene are associated with ocular albinism. PMID: 12868035
  31. Mutational analysis of the OA1 ocular albinism gene. PMID: 16646960
  32. No correlation was identified between congenital nystagmus and ocular albinism 1(OA1) gene. PMID: 16754205
  33. Our results indicate that a mutation in the GPR143 gene can cause a variant form of ocular albinism, with congenital nystagmus as the most prominent and only consistent finding in all patients in this Chinese family. PMID: 17516023
  34. Eight new mutations located in the coding region of the gene are identified. PMID: 17822861
  35. Two novel mutations in the OA1 gene were identified in two families with ocular albinism. Identified mutations are likely loss-of-function mutations. Mutations in the OA1 gene are associated with the majority of X-linked ocular albinism cases. PMID: 17960122
  36. These results indicate that this novel GPR143 mutation is associated with the congenital nystagmus observed in this Chinese family. PMID: 18523664
  37. Panretinal function in OA1 is within normal limits at all ages, consistent with previous reports in generalized albinism. PMID: 18798082
  38. Results illustrate an autocrine loop between OA1 and tyrosinase linked through L-DOPA, and this loop includes the secretion of at least one very potent retinal neurotrophic factor. PMID: 18828673
  39. These results expand the mutation spectrum of GPR143 and demonstrate the clinical characteristics of OA1 among the Chinese. PMID: 18978956
  40. The novel mutation p.G315X in the OA1 gene was identified in a Chinese family with ocular albinism, which is predicted to generate a premature stop codon. PMID: 19123159
  41. Results suggest that this novel mutation in GPR143 is associated with the congenital nystagmus observed in this Chinese family. PMID: 19390656
  42. Our results confirm that GPR143 is the major locus for X_linked ocular albinism and that exon 2 is a region of high susceptibility to deletions. PMID: 19604113
  43. A Chinese family with X-linked ocular albinism and partial deletion of GPR143 is reported. PMID: 19610097

Show More

Hide All

Database Links

HGNC: 20145

OMIM: 300500

KEGG: hsa:4935

STRING: 9606.ENSP00000417161

UniGene: Hs.74124

Involvement In Disease
Albinism ocular 1 (OA1); Nystagmus congenital X-linked 6 (NYS6)
Protein Families
G-protein coupled receptor OA family
Subcellular Location
Melanosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in the retina, including the retinal pigment epithelium (RPE), and in melanocytes. Weak expression is observed in brain and adrenal gland.

Q&A

What is GPR143 and what makes it unique among G protein-coupled receptors?

GPR143, encoded by the ocular albinism 1 (OA1) gene, is an atypical G protein-coupled receptor that distinguishes itself from conventional GPCRs through its intracellular localization. Unlike most GPCRs that function at the cell membrane, GPR143 is predominantly localized to endolysosomes and melanosomes, the organelles responsible for melanin synthesis and storage. This unusual subcellular localization represents a significant departure from canonical GPCR function and trafficking patterns. GPR143 is considered an orphan GPCR (oGPCR) as its precise signaling mechanisms and endogenous ligands remain incompletely characterized, though L-DOPA has been implicated as a potential ligand . The receptor's structure includes seven transmembrane domains typical of the GPCR family, with a full-length human GPR143 containing 404 amino acids as evident in recombinant expression systems .

What expression systems are available for producing recombinant human GPR143?

Several expression systems have been successfully employed for the production of recombinant human GPR143. The wheat germ in vitro expression system offers a eukaryotic cell-free platform suitable for expressing full-length GPR143 (NP_000264.1) without tags, incorporating the protein into proteoliposomes for structural and functional studies . Mammalian expression in HEK-293 cells has proven effective for producing GPR143 with various fusion tags (including His-tag) with high purity (>90% as determined by Bis-Tris PAGE) . For researchers requiring alternative approaches, cell-free protein synthesis (CFPS) systems have been used to generate GPR143 with Strep-tags, yielding proteins with approximately 70-80% purity suitable for various biochemical assays . Each system offers distinct advantages in terms of protein folding, post-translational modifications, and functional characteristics, with selection criteria dependent on specific experimental requirements and downstream applications.

What tissue expression profile does GPR143 demonstrate naturally?

GPR143 exhibits a complex tissue expression profile extending well beyond its initially recognized melanocyte-specific pattern. The most extensively characterized expression occurs in pigment-producing cells, including melanocytes of the skin and hair follicles, and the retinal pigment epithelium (RPE) of the eye . In the central nervous system, GPR143 shows region-specific expression patterns with particularly high levels in the cerebral cortex and hypothalamus, moderate expression in the olfactory bulb, hippocampus, midbrain and lower brain stem, and lower expression in the corpus striatum and cerebellum . Immunohistochemical analyses have identified GPR143-positive cells in additional brain regions including the habenular nucleus, substantia nigra, medulla oblongata, and nucleus tractus solitarius (NTS) . Outside the central nervous system, GPR143 expression has been documented in the convoluted tubules of the kidney (with abundance comparable to cerebral cortex expression), splenic capsule and red pulp, hepatocytes surrounding the hepatic vein, alveolar epithelial cells, bronchial tubes, and various smooth muscle cells . This widespread expression suggests functional roles extending far beyond melanogenesis.

How can researchers purify recombinant GPR143 while maintaining structural integrity?

Purification of recombinant GPR143 while preserving structural integrity requires specialized approaches tailored to membrane proteins. For wheat germ-expressed GPR143, incorporation into proteoliposomes using proprietary liposome technology provides a native-like lipid environment that helps maintain protein conformation . When expressed in HEK-293 cells with affinity tags (His or Strep), purification typically employs detergent solubilization followed by affinity chromatography under conditions that preserve protein structure. Quality assessment through multiple analytical techniques is essential, including Bis-Tris PAGE, anti-tag ELISA, Western blot, and analytical size exclusion chromatography (SEC) via HPLC . Researchers should validate protein integrity through both biochemical assays (e.g., ligand binding capacity) and biophysical methods (e.g., circular dichroism spectroscopy) to confirm proper folding. To minimize aggregation and denaturation, purification should be conducted at 4°C with stabilizing agents such as glycerol or specific lipids, and buffer conditions should be optimized to mimic the native environment of endolysosomes/melanosomes where GPR143 naturally functions.

What strategies can be employed to study ligand binding of recombinant GPR143 given its atypical intracellular localization?

Studying ligand binding of GPR143 presents unique challenges due to its atypical intracellular localization in endolysosomes and melanosomes. Traditional membrane-impermeable ligand binding assays are ineffective for intracellular receptors. Instead, researchers should employ permeabilized cell systems or isolated organelle preparations when working with cell-based assays. Recombinant systems offer greater flexibility, particularly when GPR143 is reconstituted into proteoliposomes with the binding pocket oriented outward . For direct binding studies, inside-out vesicle preparations can expose the ligand-binding domain to the experimental medium. Fluorescence-based techniques such as Förster Resonance Energy Transfer (FRET) have been successfully used to examine interactions between GPR143 and potential ligands like L-DOPA, especially when studying heteromeric complexes with other receptors such as α1b-adrenoceptor . Radioligand binding assays using cell-permeable compounds can be effective when combined with subcellular fractionation to isolate GPR143-containing organelles. Computational approaches, including molecular docking and molecular dynamics simulations, provide complementary strategies to predict and validate ligand binding sites on GPR143. Researchers should consider using multiple orthogonal approaches to overcome the limitations inherent to studying intracellular GPCRs.

How does heterodimerization of GPR143 with α1b-adrenoceptor influence experimental design and interpretation?

The discovery that GPR143 forms functional heteromers with α1b-adrenoceptor introduces significant complexity to experimental design and data interpretation. Researchers investigating GPR143 function must consider the potential confounding effects of endogenous α1b-adrenoceptor expression in their experimental systems. Co-immunoprecipitation studies have demonstrated that this heteromerization is enhanced by L-DOPA treatment (10-20 nM), suggesting ligand-dependent interaction dynamics . FRET and in situ proximity ligation assays have confirmed that these heteromers are functionally distinct from monomeric GPR143, with the heteromeric form exhibiting higher affinity for L-DOPA compared to the monomeric receptor . When designing recombinant expression systems, researchers should consider co-expressing both receptors at physiologically relevant ratios to better model native signaling. Control experiments should include selective antagonists of α1b-adrenoceptor to distinguish between direct GPR143 effects and those mediated through heteromer formation. The potential formation of heteromers necessitates careful interpretation of pharmacological data, as drug responses may differ between monomeric and heteromeric receptor populations. Additionally, tissue-specific expression patterns of both receptors should inform the relevance of heteromer-focused studies to particular physiological or pathological contexts, such as pulmonary hypertension where both receptors may play contributory roles .

What are the methodological considerations for studying GPR143 mutations associated with ocular albinism?

Studying GPR143 mutations associated with ocular albinism requires a systematic approach integrating molecular, cellular, and functional analyses. For recombinant expression studies, researchers should generate a panel of constructs reflecting the diversity of reported mutations (missense, nonsense, frameshift, and splicing mutations) in the OA1 gene. Expression systems should be selected based on their ability to recapitulate physiologically relevant post-translational modifications and trafficking pathways, with melanocyte or RPE cell lines offering advantages for studying cell type-specific effects. Subcellular localization analysis using confocal microscopy with organelle-specific markers is essential to determine whether mutations affect GPR143 trafficking to melanosomes/endolysosomes. Biochemical characterization should assess protein stability, glycosylation status, and ligand binding capacity of mutant receptors compared to wild-type. Functional assays should evaluate G protein coupling efficiency and downstream signaling cascades, including calcium mobilization, cAMP production, and MAPK pathway activation. For more physiologically relevant assessments, CRISPR/Cas9-mediated knock-in of specific mutations in melanocyte or RPE cell lines can provide insights into effects on melanosome biogenesis and maturation. Electron microscopy should be employed to characterize melanosome ultrastructure, as GPR143 mutations typically result in macromelanosomes. When interpreting results, researchers should consider potential compensatory mechanisms and the possibility that different mutations may cause disease through distinct molecular mechanisms.

What techniques are most effective for studying the role of GPR143 in cancer progression and metastasis?

Investigation of GPR143's role in cancer progression and metastasis requires multi-dimensional approaches spanning molecular, cellular, and in vivo techniques. Gene expression modulation through lentiviral overexpression and siRNA-mediated knockdown has successfully demonstrated that GPR143 expression levels positively correlate with melanoma cell migration capabilities . When working with recombinant GPR143, researchers should establish stable cell lines with inducible expression systems to permit precise temporal control over protein levels. Migration and invasion assays (transwell, wound healing, 3D invasion) represent critical functional readouts, while proliferation and colony formation assays address tumor growth potential. Mechanistic studies should focus on downstream signaling, particularly the RAS/RAF/MEK/ERK pathway that has been linked to GPR143-induced melanoma cell metastasis . Protein-protein interaction studies using proximity ligation assays, co-immunoprecipitation, and FRET can identify cancer-relevant binding partners. For in vivo validation, orthotopic xenograft models with GPR143-modulated cancer cells enable assessment of tumor growth and metastatic potential. Immunohistochemical analysis of patient samples should evaluate correlations between GPR143 expression and clinical outcomes, building on observations that GPR143 expression increases with progression toward metastasis in melanoma . Additionally, researchers should investigate connections between GPR143 and immune infiltration in tumors, as this correlation has been reported in cutaneous melanoma . Single-cell RNA sequencing can provide valuable insights into GPR143 expression heterogeneity within tumors and its relationship to cancer stem cell populations.

How can researchers reliably detect GPR143 in experimental systems given challenges with antibody specificity?

Reliable detection of GPR143 in experimental systems requires strategic approaches to overcome challenges with antibody specificity for this intracellular GPCR. When working with recombinant proteins, incorporation of epitope tags (His, Strep, GST) facilitates detection using well-characterized anti-tag antibodies with established specificity . For endogenous GPR143 detection, researchers should employ rigorous antibody validation through multiple complementary methods. Western blot analysis should include positive controls (recombinant GPR143), negative controls (knockout or knockdown samples), and peptide competition assays to confirm specificity. Immunofluorescence microscopy should demonstrate colocalization with established melanosomal/endolysosomal markers (LAMP1, PMEL) and show expected subcellular distribution patterns. Antibody specificity should be validated across multiple tissue types given the diverse expression profile of GPR143 . Alternative detection methods include RNAscope in situ hybridization for mRNA localization and mass spectrometry-based proteomics for protein identification in complex samples. For researchers generating new antibodies, epitope selection should carefully consider regions of GPR143 with minimal homology to other GPCRs, targeting either the N-terminal domain or specific intracellular loops. Knockout validation using CRISPR/Cas9-edited cell lines provides the most stringent control for antibody specificity. Publication of detailed validation protocols and reagent information enhances reproducibility across research groups studying this challenging receptor.

What methodology should researchers employ to investigate GPR143 signaling pathways in neuronal contexts?

Investigation of GPR143 signaling pathways in neuronal contexts requires specialized approaches that account for both the receptor's intracellular localization and the complexity of neuronal signaling networks. Primary neuronal cultures from regions with high GPR143 expression (cerebral cortex, hypothalamus) offer physiologically relevant systems, while neuronal cell lines provide more standardized alternatives for initial characterization. For recombinant studies, lentiviral vectors enabling neuron-specific promoter-driven expression are preferable to conventional transfection methods. Live-cell calcium imaging using genetically encoded calcium indicators permits real-time monitoring of signaling events in intact neurons with subcellular resolution. FRET-based sensors targeted to specific organelles (endolysosomes) can detect localized G protein activation in proximity to GPR143. Phosphoproteomic analyses following L-DOPA stimulation (10-20 nM) can comprehensively identify downstream signaling targets, while pathway-specific reporter assays provide focused readouts for canonical G protein pathways. Given GPR143's potential role in Parkinson's disease and L-DOPA response , dopaminergic neurons derived from patient-specific induced pluripotent stem cells offer valuable disease-relevant models. Chemogenetic approaches using designer receptors exclusively activated by designer drugs (DREADDs) with subcellular targeting sequences can help dissect the contribution of organelle-specific GPCR signaling. When interpreting results, researchers should consider potential cross-talk between GPR143 and other neurotransmitter receptors, particularly in brain regions where GPR143 expression overlaps with dopaminergic, angiotensinergic, and adrenergic receptor expression .

How can researchers accurately assess the potential therapeutic targeting of GPR143 in melanoma and other cancers?

Accurate assessment of GPR143 as a therapeutic target in melanoma and other cancers requires a comprehensive evaluation strategy spanning in vitro, in vivo, and clinical correlation approaches. Cancer cell line panels representing different progression stages and genetic backgrounds should be screened for GPR143 expression and correlation with invasive properties. Patient-derived xenografts and organoids offer more faithful recapitulation of tumor heterogeneity for therapeutic testing. For target validation, CRISPR/Cas9 knockout or inducible shRNA systems provide more specific GPR143 inhibition than traditional siRNA approaches. High-throughput screening platforms using GPR143-expressing cell lines can identify small molecule modulators, with counterscreens in GPR143-knockout cells to confirm specificity. Lead compounds should be evaluated for their impact on established GPR143-regulated pathways, particularly the RAS/RAF/MEK/ERK signaling cascade implicated in melanoma metastasis . Given GPR143's intracellular localization, compound design must prioritize membrane permeability to access the target. In vivo efficacy studies should utilize orthotopic tumor models with metastasis monitoring capabilities. Biomarker development should explore correlations between GPR143 expression and immune infiltration patterns , as well as potential associations with treatment resistance, building on observations of melanosome-related proteins in chemoresistant melanoma . Immunohistochemical analysis of patient samples with outcome correlation can identify patient subgroups most likely to benefit from GPR143-targeted therapies. This multi-dimensional approach provides the robust pre-clinical evidence necessary to advance GPR143-targeted therapies toward clinical development.

What techniques are most appropriate for investigating the potential role of GPR143 in L-DOPA treatment for Parkinson's disease?

Investigating GPR143's potential role in L-DOPA treatment for Parkinson's disease requires specialized techniques spanning molecular, cellular, and in vivo approaches. Recombinant GPR143 binding assays using varying concentrations of L-DOPA (1-100 nM) can establish direct interaction and binding kinetics. Co-expression systems with GPR143 and α1b-adrenoceptor are particularly important given evidence of heteromer formation enhanced by L-DOPA treatment . In neuronal models, knockdown/knockout studies can determine whether GPR143 is necessary for specific L-DOPA effects. Electrophysiological recordings in dopaminergic neurons following L-DOPA administration can assess acute effects on neuronal activity with and without GPR143 manipulation. Microdialysis in animal models can measure dopamine release patterns in response to L-DOPA under conditions of GPR143 modulation. GPR143 transgenic mouse models (both knockout and conditional knockout) treated with L-DOPA should undergo comprehensive behavioral assessment using established protocols for measuring Parkinson's-like symptoms. PET imaging with radiolabeled L-DOPA can examine whether GPR143 status affects drug distribution and metabolism in vivo. Investigation of potential neuroprotective effects should include cellular stress models and assessment of neurogenesis in the hippocampus, following reports that L-DOPA-induced neurogenesis might be mediated by GPR143 . Analysis of human post-mortem brain samples from Parkinson's patients (both L-DOPA-treated and untreated) can provide correlative evidence for GPR143 involvement. Researchers should carefully consider that GPR143-immunoreactive signals have been observed in both control and Parkinson's disease brains in the midbrain region including the substantia nigra pars compacta , suggesting complex relationships in disease pathophysiology.

What are the optimal conditions for expressing full-length recombinant human GPR143 with proper folding and functionality?

Optimizing expression of properly folded and functional recombinant human GPR143 requires careful consideration of expression systems and conditions. The wheat germ in vitro expression system has demonstrated success in generating full-length GPR143 (NP_000264.1) without tags, incorporating the protein into proteoliposomes that support native-like folding . For mammalian expression, HEK-293 cells provide appropriate post-translational modification machinery, with expression typically driven by CMV promoters in tetracycline-inducible systems that allow control over expression levels. Codon optimization specific to the expression host improves translation efficiency while fusion of GPR143 to stability-enhancing partners (SUMO, thioredoxin) can increase protein yield without compromising structure. Expression at reduced temperatures (28-30°C for mammalian cells) often improves folding by slowing production and allowing chaperones to function more effectively. Cell-free protein synthesis systems offer advantages for difficult membrane proteins, with yields of 70-80% purity for GPR143 reported . For all systems, inclusion of specific lipids during expression/purification helps stabilize the protein in a functionally relevant conformation. Functionality assessment should include ligand binding assays (with putative ligand L-DOPA), G-protein coupling analysis, and validation of proper subcellular localization in cell-based systems. Size exclusion chromatography profiles should confirm monodisperse protein populations rather than aggregates. Expression optimization typically requires systematic testing of multiple conditions, including expression duration, inducer concentration, and buffer composition, with success assessed through both yield and functional metrics specific to GPR143.

How can researchers develop reliable assays to screen for novel ligands or modulators of GPR143 activity?

Developing reliable assays for novel GPR143 ligand/modulator screening requires innovative approaches that address its intracellular localization and orphan receptor status. Cell-based reporter systems should employ melanocyte or RPE cell lines with endogenous GPR143 expression or recombinant cells with stable GPR143 expression targeted to endolysosomes/melanosomes. CRISPR/Cas9-engineered cell lines with fluorescent or luminescent tags knocked into endogenous GPR143 loci provide physiologically relevant expression levels. For direct binding assays, thermal shift assays using purified GPR143 in proteoliposomes can identify compounds that stabilize receptor conformation. Label-free technologies such as surface plasmon resonance or microscale thermophoresis using recombinant GPR143 offer advantages for initial binding characterization. Functional assays should focus on established downstream events, including MAPK pathway activation , melanosome biogenesis regulation, and calcium signaling. Bioluminescence resonance energy transfer (BRET) assays designed to detect G protein activation or β-arrestin recruitment should be adapted for intracellular compartments through appropriate targeting sequences. High-content imaging platforms can assess compound effects on melanosome morphology, number, and distribution in melanocytes or RPE cells. Virtual screening approaches using homology models of GPR143 provide computational pre-screening to prioritize compounds for experimental testing. For validation of hits, orthogonal assays and counter-screens in GPR143-knockout cells are essential to confirm target specificity. When designing compound libraries, researchers should consider the chemical properties necessary for compounds to reach intracellular compartments and include known melanogenesis modulators as reference compounds.

What experimental approaches can effectively characterize GPR143 protein-protein interactions within melanosomes and endolysosomes?

Characterizing GPR143 protein-protein interactions within melanosomes and endolysosomes requires specialized techniques that preserve the integrity of these organelles while enabling sensitive detection of interaction partners. Proximity-dependent biotinylation approaches (BioID, TurboID) with GPR143 as the bait protein can identify the proximal interactome within intact organelles in living cells. APEX2 (engineered ascorbate peroxidase) fusion to GPR143 offers an alternative proximity labeling strategy with finer temporal resolution. For validated or suspected interactions, such as with α1b-adrenoceptor , Förster Resonance Energy Transfer (FRET) and in situ proximity ligation assays provide spatial information and can detect dynamic, stimulus-dependent interactions following L-DOPA treatment. Immunoprecipitation of GPR143 from isolated melanosomes or endolysosomes followed by mass spectrometry enables unbiased interactome mapping, though careful validation is essential. Split-protein complementation assays with organelle-targeted components can confirm direct interactions in living cells. Yeast two-hybrid screening using GPR143 domains as bait can identify potential interactors, though secondary validation in mammalian cells is crucial. Co-localization studies using super-resolution microscopy techniques (STORM, PALM) can resolve protein distributions within individual organelles at nanometer resolution. For structural characterization of stable complexes, single-particle cryo-electron microscopy of purified complexes offers the potential for near-atomic resolution. When interpreting interaction data, researchers should consider the dynamic nature of endolysosomal/melanosomal compartments and validate findings across multiple cell types and experimental conditions to identify conserved interaction partners distinct from cell-specific associations.

How might single-cell technologies advance our understanding of GPR143 expression heterogeneity in different tissues?

Single-cell technologies offer unprecedented opportunities to characterize GPR143 expression heterogeneity across tissues and disease states. Single-cell RNA sequencing (scRNA-seq) can identify previously unrecognized cell populations expressing GPR143 beyond the established expression in melanocytes, RPE cells, and specific neuronal populations . This approach is particularly valuable for resolving expression differences in heterogeneous tissues like brain regions, where GPR143 shows variable expression patterns across neuronal subtypes. For protein-level analysis, mass cytometry (CyTOF) with GPR143-specific antibodies can quantify expression across thousands of individual cells while simultaneously measuring dozens of other proteins to establish correlation networks. Spatial transcriptomics techniques maintain tissue architecture information while providing single-cell resolution of GPR143 mRNA expression, critical for understanding regional variation within complex tissues. For subcellular resolution, multiplexed ion beam imaging (MIBI) or imaging mass cytometry can localize GPR143 protein within specific cellular compartments across numerous cells in tissue sections. In disease contexts, single-cell approaches can reveal shifts in GPR143-expressing cell populations that would be masked in bulk tissue analyses. For cancer research, combined single-cell genotyping and transcriptomics can correlate GPR143 expression with specific genetic alterations in individual tumor cells. Integration of single-cell data across tissues can generate a comprehensive atlas of GPR143 expression that contextualizes its diverse roles beyond pigmentation, including potential functions in neurological disorders , cancer progression , and other pathological states where GPR143-expressing cells may contribute to disease mechanisms.

What are the most promising approaches for developing GPR143-targeted therapeutics given its intracellular localization?

Developing GPR143-targeted therapeutics presents unique challenges due to its intracellular localization in endolysosomes and melanosomes, requiring innovative drug delivery strategies and mechanism-based approaches. Small molecule development should focus on membrane-permeable compounds with physiochemical properties favoring accumulation in acidic endolysosomal compartments, potentially leveraging ionizable moieties that become charged in the acidic lumen. Structure-based drug design utilizing homology models of GPR143 can guide rational development of ligands targeting key binding pockets. For biologics, engineered antibody fragments or nanobodies with cell-penetrating peptides can be designed to recognize specific epitopes on GPR143. RNA-based therapeutics, including siRNA or antisense oligonucleotides targeting GPR143 mRNA, offer an alternative approach for modulating expression levels rather than directly targeting the protein. Cell-penetrating peptides derived from GPR143 interaction interfaces can disrupt specific protein-protein interactions, such as the heteromerization with α1b-adrenoceptor . Nanoparticle-based delivery systems with endolysosomal targeting properties can improve the delivery of conventional therapeutics to GPR143-containing compartments. For melanoma applications, melanocyte-targeting strategies utilizing melanin biosynthesis pathways can enhance selective drug delivery. In neurodegenerative contexts such as Parkinson's disease, where GPR143 may play a role in L-DOPA response , blood-brain barrier penetration must be considered alongside organelle targeting. Regardless of the therapeutic modality, validation studies should employ multiple model systems with appropriate subcellular markers to confirm target engagement within the correct organellar compartments where GPR143 functions.

How can computational modeling and simulation contribute to understanding GPR143 structure-function relationships?

Computational modeling and simulation provide powerful tools for understanding GPR143 structure-function relationships in the absence of experimentally determined structures. Homology modeling using related GPCRs as templates can generate preliminary structural models of GPR143, with special consideration for its unique intracellular localization and potential ligand binding domains. These models should undergo rigorous validation through multiple scoring functions and comparison with experimental data on known GPR143 mutations associated with ocular albinism. Molecular dynamics simulations in complex membrane environments mimicking endolysosomal/melanosomal membranes can reveal dynamic conformational changes and identify stable ligand binding poses for compounds like L-DOPA. Quantum mechanics/molecular mechanics (QM/MM) approaches can provide detailed insights into potential catalytic or ligand recognition mechanisms. Structure-based virtual screening against the modeled binding pocket can identify novel potential ligands for experimental validation. Protein-protein docking simulations can predict interaction interfaces between GPR143 and partners such as α1b-adrenoceptor or components of the RAS/RAF/MEK/ERK signaling pathway implicated in melanoma progression . Network pharmacology approaches integrating protein interaction networks with GPR143 signaling pathways can identify potential points for therapeutic intervention. For experimental validation of computational predictions, site-directed mutagenesis of recombinant GPR143 at key predicted binding residues should be correlated with functional outcomes in cellular assays. Machine learning approaches integrating available experimental data on GPR143 mutations, expression patterns, and disease associations can generate testable hypotheses about structure-function relationships. As experimental structural data becomes available, iterative refinement of computational models will progressively enhance their predictive power for drug design and mechanistic understanding.

What are the most critical knowledge gaps that currently limit GPR143 research, and how might they be addressed?

Several critical knowledge gaps currently constrain progress in GPR143 research, each requiring targeted approaches to advance understanding of this atypical intracellular GPCR. The lack of a definitive three-dimensional structure represents perhaps the most fundamental limitation, as it impedes rational drug design and detailed mechanistic understanding. This gap could be addressed through intensive structural biology efforts using cryo-electron microscopy or X-ray crystallography of stabilized recombinant GPR143, potentially employing fusion proteins or antibody fragments to facilitate crystallization. The incomplete characterization of GPR143's endogenous ligand(s) and signaling mechanisms represents another major limitation, necessitating comprehensive unbiased screening approaches coupled with advanced proteomics and metabolomics to identify physiologically relevant binding partners beyond the proposed L-DOPA interaction . The precise role of GPR143 in non-pigmentary tissues remains poorly understood despite its widespread expression , requiring tissue-specific knockout models to elucidate functions in diverse contexts including neurological disorders and cancer. The mechanisms linking GPR143 dysfunction to melanosome biogenesis abnormalities in ocular albinism need further clarification through detailed molecular cell biology approaches. Additionally, the functional significance of GPR143's intracellular localization versus conventional plasma membrane GPCRs remains incompletely understood, potentially requiring targeted relocalization studies to compare signaling outcomes from different subcellular compartments. Addressing these knowledge gaps through coordinated multidisciplinary research will substantially advance both fundamental understanding of this unique receptor and its potential applications in therapeutic development for ocular albinism, melanoma, and potentially other conditions where GPR143 plays contributory roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.