Recombinant Human G-protein coupled receptor 157 (GPR157)

Shipped with Ice Packs
In Stock

Description

Role in Neurodevelopment

GPR157 localizes to primary cilia of radial glial progenitors (RGPs) in the developing neocortex, where it regulates neuronal differentiation via Gαq-IP3-Ca²⁺ signaling . Key findings include:

  • Knockdown effects: Reduces TBR2⁺ intermediate progenitors by 40% and TUJ1⁺ neurons by 25% in embryonic cortices .

  • Calcium signaling: Overexpression increases cytosolic Ca²⁺ levels by 2.5-fold in vitro, dependent on IP3 receptor activity .

  • Cerebrospinal fluid (CSF) activation: E13 CSF increases GPR157-mediated AP-TGFα cleavage by 3.2× compared to E10 CSF, correlating with enhanced neurogenic potential .

Signaling Mechanism

GPR157 operates through a conserved pathway:

  1. Ligand binding: Putative CSF-derived agonists activate the receptor .

  2. G-protein coupling: Engages Gαq, triggering PLCβ-mediated IP3 production .

  3. Downstream effects: IP3-induced Ca²⁺ release promotes RGP differentiation into neurons .

Research Applications

Recombinant GPR157 is critical for:

  • Antibody development: Used to generate anti-GPR157 antibodies validated in Western blotting and immunohistochemistry .

  • Pathway analysis: Identified as a regulator of cytosolic calcium in RGPs via IP3 sponge and Gαq-CT inhibition assays .

  • Drug screening: Serves as a target in GPCR-focused compound libraries .

Clinical and Evolutionary Insights

  • Disease associations: Linked to stromal dystrophy and Schnyder crystalline corneal dystrophy (SCCD) .

  • Evolutionary conservation: Shares homology with Dictyostelium discoideum cAMP receptors, suggesting ancient signaling roles .

Product Specs

Buffer
For liquid delivery, the default storage buffer is a Tris/PBS-based solution containing 5-50% glycerol. Note: Specify any glycerol concentration requirements when ordering.
Form
Delivery format: Liquid or Lyophilized Powder. Note: While we prioritize shipping the available format, please specify your preferred format when ordering to ensure fulfillment of your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure the contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized powder has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag.
Synonyms
GPR157; G-protein coupled receptor 157
Datasheet & Coa
Please contact us to get it.
Expression Region
1-335aa
Mol. Weight
39.4 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Signal Transduction
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
GPR157
Target Protein Sequence
MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
GPR157 is an orphan receptor that promotes neuronal differentiation of radial glial progenitors (RGPs). Its activity is mediated by a G(q)-protein, activating a phosphatidylinositol-calcium second messenger system.
Database Links

HGNC: 23687

KEGG: hsa:80045

UniGene: Hs.632367

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

What is GPR157 and where is it primarily expressed in human tissue?

GPR157 is an orphan G protein-coupled receptor that shows distinctive expression patterns during development. In the developing neocortex, GPR157 is predominantly expressed in radial glial progenitors (RGPs). Immunohistochemical analysis reveals that GPR157 is enriched in RGPs but not significantly expressed in TBR2-positive intermediate progenitors or βIII-tubulin (TUJ1)-positive neurons . The receptor notably localizes to the primary cilia of RGPs that are exposed to cerebrospinal fluid (CSF) in the ventricular zone, suggesting its potential role in sensing extracellular signals from the CSF during neurogenesis .

What are the primary signaling pathways activated by GPR157?

GPR157 primarily couples with the Gq-class of heterotrimeric G-proteins and signals through IP3-mediated Ca2+ cascades. Experimental evidence shows that overexpression of GPR157 induces an increase in intracellular calcium concentration ([Ca2+]i) in both U-2 OS cells and cultured RGPs . This GPR157-evoked increase in [Ca2+]i can be partially prevented by co-expression of Gαq-CT (C-terminal regions of Gα), which acts as a competitive blocker for GPCR-G protein signaling . The signaling pathway proceeds through:

  • GPR157 activation

  • Gq-protein coupling

  • PLC-IP3 pathway activation

  • Ca2+ release from intracellular stores

  • Downstream cellular responses

How does GPR157 influence neuronal differentiation and development?

GPR157 plays a crucial role in regulating neuronal differentiation of radial glial progenitors. Knockdown of GPR157 using shRNA constructs results in:

  • Increased population of PAX6-positive RGPs

  • Decreased fraction of TBR2-positive intermediate progenitors

  • Impaired neuronal differentiation in the developing neocortex

These effects occur without significant changes in cell proliferation or apoptosis, suggesting that GPR157 specifically regulates the differentiation process rather than progenitor survival or proliferation . At later neurodevelopmental stages, GPR157 knockdown leads to altered cell distribution in cortical layers, with more cells remaining in the intermediate zone and ventricular zone and fewer cells reaching the cortical plate .

What potential ligands activate GPR157 and how are they identified?

While GPR157 is considered an orphan receptor, research indicates the presence of putative ligand(s) in the cerebrospinal fluid (CSF). The ability of CSF to activate GPR157 increases during the neurogenic phase of development . Researchers have developed a GPCR assay system to detect GPR157 activation by potential ligands. In this system:

  • GPR157 is transfected into U-2 OS cells along with TGFα whose ectodomain is fused with Alkaline Phosphatase (AP-TGFα)

  • Upon ligand binding to GPR157, endogenous TACE is activated by Gq and cleaves the TGFα ectodomain

  • This results in AP release into the media

  • The ratio of AP activity in the media to total AP activity is measured as the GPR157-activation index

Using this assay, researchers found that CSF collected from E13 embryonic lateral ventricles significantly increased the relative AP activity in GPR157-transfected cells compared to mock-transfected cells, suggesting the presence of GPR157 ligands in embryonic CSF .

What experimental approaches are most effective for studying GPR157 activation and signaling?

Several complementary methodologies have proven effective for investigating GPR157 function:

Calcium Imaging Assays: Measuring intracellular calcium concentration changes ([Ca2+]i) following GPR157 activation provides a direct readout of receptor function. This has been successfully applied in both U-2 OS cells and primary RGPs expressing recombinant GPR157 .

Alkaline Phosphatase (AP) Release Assay: This technique measures GPR157 activation through the release of AP from AP-TGFα fusion proteins upon receptor activation. The ratio of released AP to total AP serves as a quantitative measure of receptor activation and allows testing of potential ligands .

In Utero Electroporation: For in vivo functional studies, introduction of GPR157 expression constructs or shRNAs via in utero electroporation enables manipulation of GPR157 levels in specific neural progenitor populations during embryonic development. This approach allows assessment of phenotypic consequences in the developing brain .

Signaling Pathway Inhibition: To dissect downstream pathways, co-expression of inhibitory peptides like Gαq-CT or IP3 sponge together with GPR157 can reveal the contribution of specific signaling components to GPR157-mediated cellular responses .

How does subcellular localization of GPR157 to primary cilia impact experimental design?

The enrichment of GPR157 in primary cilia of RGPs creates unique considerations for experimental design:

  • Specialized Immunostaining Techniques: En face views of the ventricular surface and co-staining with ciliary markers like acetylated tubulin (Ac-TUB) are required to visualize GPR157 localization in primary cilia .

  • Non-uniform Distribution: GPR157 appears to localize to specific subdomains within cilia rather than uniformly along the entire ciliary length, necessitating high-resolution imaging techniques .

  • Functional Relevance: The positioning of GPR157-containing cilia in contact with CSF suggests experiments should consider the role of CSF-derived ligands in receptor activation .

  • Ciliary Transport Mechanisms: Research designs should account for mechanisms that target GPR157 to cilia, which may involve specialized trafficking pathways distinct from those used by other membrane proteins .

  • Comparative Analysis: When studying GPR157 function, comparison with other ciliary GPCRs may provide insights into common mechanisms of ciliary GPCR signaling .

What are the primary challenges in developing stable cell lines expressing functional GPR157?

Creating stable cell lines expressing GPR157 presents several technical challenges that researchers should consider:

  • Selection Strategy: Successful establishment of hGPR157-HEK293A stable cell lines requires careful selection with antibiotics such as G418 (500 μg/ml) as demonstrated in previous studies .

  • Expression Level Control: Over-expression of GPCRs can lead to ligand-independent activation, potentially masking ligand-dependent effects. Titration of expression levels is crucial for maintaining receptor functionality .

  • Functional Verification: Validation of receptor functionality through calcium signaling or other readouts is essential before using the cell line for experimental applications .

  • Receptor Trafficking: Ensuring proper trafficking of the receptor to the plasma membrane, particularly to specialized domains like cilia when relevant, requires verification through subcellular localization studies .

  • Culture Conditions: Maintenance of stable GPR157-expressing cell lines requires specific culture conditions, including DMEM supplemented with 10% dFBS and continuous selection pressure with G418 .

How can GPR157-Gq signaling be experimentally manipulated in research settings?

Several approaches have been developed to modulate GPR157-Gq signaling for experimental purposes:

Gain-of-Function Approaches:

  • Overexpression of wild-type GPR157 in target cells

  • Expression of constitutively active Gαq mutants (e.g., Gαq Q209L) to mimic downstream pathway activation

Loss-of-Function Approaches:

  • RNA interference using GPR157-specific shRNAs to knockdown receptor expression

  • Inhibition of Gq signaling using Gαq-CT peptides that compete for receptor binding

  • Sequestration of IP3 using IP3 sponge constructs to block downstream calcium signaling

Pathway Manipulation:

  • Pertussis toxin (PTX) treatment (100 ng/ml, 24h before experiments) to inhibit Gi/o signaling and isolate Gq-mediated effects

  • Calcium chelators to block downstream effects of GPR157-induced calcium mobilization

These tools allow researchers to dissect the specific contributions of GPR157-Gq signaling to cellular processes like neuronal differentiation.

How does GPR157 compare functionally with other G-protein coupled receptors?

GPR157 exhibits several distinctive features compared to other GPCRs:

  • Subcellular Localization: GPR157 shows enrichment in primary cilia, placing it in a specialized group of ciliary GPCRs with access to the extracellular environment of ventricles .

  • Signaling Specificity: Unlike some GPCRs that couple to multiple G protein subtypes, GPR157 appears to signal predominantly through the Gq pathway and subsequent IP3-mediated calcium release .

  • Evolutionary Conservation: Recent comparative analysis suggests potential similarities between mammalian GPR157 and the plant protein GCR1, raising interesting evolutionary questions about GPCR signaling across kingdoms .

  • Ligand Specificity: While GPR15, another GPCR, is activated by specific peptides like GPR15L(25-81) and GPR15L(71-81), ligands for GPR157 remain to be fully characterized, though evidence suggests their presence in CSF .

  • Disease Associations: Unlike GPR15, which has been implicated in myocardial infarction and various immune disorders , the disease associations of GPR157 are still being elucidated, with a primary focus currently on neurodevelopmental roles .

What are the emerging roles of GPR157 in pathophysiological conditions?

While research on GPR157's involvement in disease states is still emerging, several potential roles can be inferred from current evidence:

  • Neurodevelopmental Disorders: Given GPR157's crucial role in neuronal differentiation during cortical development, dysregulation of GPR157 signaling could potentially contribute to neurodevelopmental disorders .

  • Ciliopathies: As a ciliary GPCR, GPR157 dysfunction might play a role in ciliopathies, a diverse group of disorders caused by abnormal ciliary structure or function .

  • Cardiovascular Conditions: By comparison, the related GPCR GPR15 shows upregulation in myocardial infarction and conditions of ischemia, with knockout mice showing reduced survival after MI induction. Similar studies are warranted for GPR157 .

  • Therapeutic Target Potential: Unlike some chemokine receptors that show redundancy in their interactions, the specificity of GPR157 signaling might offer advantages for developing targeted therapeutics for conditions where it plays a pathological role .

What are the optimal conditions for culturing cells expressing recombinant GPR157?

Based on established protocols, the following conditions are recommended for culturing cells expressing recombinant GPR157:

For HEK293A Cells (Parental Line):

  • Culture Medium: DMEM supplemented with 10% dFBS and 100 U/ml penicillin-streptomycin

  • Culture Conditions: 37°C in a humidified 5% CO2 atmosphere

  • Passage Limitations: Use cells under passage 30 to maintain consistent receptor expression

For Stable hGPR157-HEK293A Cell Lines:

  • Selection Medium: DMEM supplemented with 10% dFBS and 500 μg/ml G418

  • Establishment: Selection with G418 following transfection with human GPR157 expression constructs

  • Maintenance: Continuous culture in selection medium to maintain receptor expression

For Primary Neuronal Cultures Expressing GPR157:

  • Following in utero electroporation with GPR157 expression constructs, primary cultures of labeled cells can be established and maintained for functional studies

  • These cultures retain their identity as SOX2-positive RGPs (>96%) for at least 24 hours in culture

What experimental controls are essential when studying GPR157 function?

To ensure robust and interpretable results in GPR157 research, the following controls should be implemented:

For Knockdown Studies:

  • Control shRNA with similar nucleotide composition but not targeting any known gene

  • Rescue experiments using shRNA-resistant GPR157 constructs to confirm specificity of knockdown phenotypes

  • Assessment of cell cycle progression (e.g., BrdU labeling) and apoptosis to exclude confounding effects

For Overexpression Studies:

  • Empty vector controls subjected to identical transfection conditions

  • Co-expression with pathway inhibitors (Gαq-CT, IP3 sponge) to confirm signaling specificity

  • Constitutively active Gαq as a positive control for downstream pathway activation

For Antibody Validation:

  • Pre-absorption controls using the immunization antigen to confirm antibody specificity

  • shRNA-mediated knockdown samples to verify antibody specificity in tissue sections

  • Negative controls using tissues known not to express GPR157

For Ligand Identification:

  • Mock-transfected cells as negative controls in activation assays

  • Comparison of activation potentials between different physiological sources (e.g., CSF from different developmental stages)

What experimental approaches can identify endogenous ligands for GPR157?

Identifying endogenous ligands for orphan receptors like GPR157 requires systematic approaches:

Bioassay-Guided Fractionation:

  • Collect potential ligand-containing samples (e.g., CSF from lateral ventricles)

  • Fractionate samples using chromatographic techniques

  • Test fractions using the GPR157 activation assay (AP-TGFα release system)

  • Further purify active fractions and identify components via mass spectrometry

Candidate Approach:

  • Test known signaling molecules found in CSF for their ability to activate GPR157

  • Focus on molecules whose concentrations change during neurogenic phases

  • Validate candidates using dose-response curves in the GPR157 activation assay

Comparative Analysis:

  • Compare the activation potential of CSF collected from different developmental stages (e.g., E10 vs. E13)

  • Identify molecules that show concentration changes correlating with activation potential

  • Test these molecules individually in the GPR157 activation assay

Genetic Approaches:

  • Screen for genetic mutations that affect GPR157 signaling in vivo

  • Identify pathway components that might produce or process GPR157 ligands

  • Test whether manipulation of these components affects ligand availability

What are the most promising avenues for future GPR157 research?

Several key areas warrant further investigation to advance our understanding of GPR157 biology:

  • Ligand Identification: Continued efforts to identify and characterize endogenous ligands for GPR157, particularly those present in CSF during neurogenic phases .

  • Structural Studies: Determination of GPR157's three-dimensional structure to understand its activation mechanism and facilitate drug design.

  • Transgenic Models: Development of conditional GPR157 knockout mouse models to dissect cell-type specific roles of GPR157 in development and disease.

  • Disease Associations: Investigation of GPR157's potential involvement in neurodevelopmental disorders, ciliopathies, and other pathological conditions.

  • Evolutionary Conservation: Further exploration of the suggested similarities between mammalian GPR157 and plant GCR1 to understand the evolution of GPCR signaling mechanisms across kingdoms .

  • Therapeutic Applications: Assessment of GPR157 as a potential therapeutic target, particularly in contexts where modulation of neuronal differentiation might be beneficial.

  • Interaction with Other Signaling Pathways: Elucidation of how GPR157-Gq signaling interacts with other developmental signaling pathways to coordinate neurogenesis.

What technological advances would most benefit GPR157 research?

Advancement in several technologies would significantly enhance research into GPR157 function:

  • CRISPR/Cas9 Gene Editing: For precise manipulation of GPR157 in various cell types and model organisms.

  • Single-Cell Transcriptomics: To better understand the heterogeneity of GPR157 expression across cell populations and developmental stages.

  • Advanced Imaging Techniques: Super-resolution microscopy and live-cell imaging to visualize GPR157 localization and trafficking in real-time.

  • Chemogenetic Tools: Development of designer GPR157 variants that can be activated by synthetic ligands for temporal control of signaling.

  • Computational Modeling: Prediction of GPR157 structure, ligand binding sites, and signaling dynamics to guide experimental approaches.

  • Organoid Models: Use of brain organoids to study GPR157 function in a three-dimensional context that better recapitulates in vivo development.

  • Proteomics: Identification of GPR157 interaction partners and signaling complexes to fully map its signaling network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.