Recombinant Human G-protein coupled receptor 157 (GPR157)-VLPs

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from PBS, containing 6% Trehalose, pH 7.4.
Form
Lyophilized powder.
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you require shipping in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance, as additional fees will be charged for dry ice and the dry ice container.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C and avoid repeated freeze-thaw cycles to ensure optimal protein activity.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged.
If you have a specific tag type in mind, please let us know, and we will investigate its feasibility for development.
Synonyms
GPR157; G-protein coupled receptor 157
Datasheet & Coa
Please contact us to get it.
Expression Region
1-335aa
Research Area
Signal Transduction
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
GPR157
Target Protein Sequence
MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
GPR157, an orphan receptor, promotes neuronal differentiation of radial glial progenitors (RGPs). Its activity is mediated by a G(q)-protein, which activates a phosphatidylinositol-calcium second messenger pathway.
Database Links

HGNC: 23687

KEGG: hsa:80045

UniGene: Hs.632367

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

Basic Structure and Function of GPR157-VLPs

The fundamental understanding of GPR157-VLPs begins with characterizing their molecular structure and signaling properties. GPR157 is an orphan G protein-coupled receptor that localizes to primary cilia and signals through Gq-class heterotrimeric G-proteins, activating IP3-mediated Ca2+ cascades. When incorporated into VLPs, this receptor maintains its native conformation while benefiting from the structural stability of the particle scaffold.

What is GPR157 and what cellular functions does it regulate?

GPR157 is an orphan G protein-coupled receptor that localizes to the primary cilia of radial glial progenitors (RGPs) where it is exposed to cerebrospinal fluid (CSF). Research demonstrates that GPR157 couples with Gq-class of heterotrimeric G-proteins and signals through IP3-mediated Ca2+ cascade. This signaling pathway plays a crucial role in enhancing neuronal differentiation of RGPs, as activation of GPR157-Gq signaling promotes neurogenesis while interference with this cascade suppresses it . Studies involving GPR157 knockdown reveal an increased population of PAX6-positive RGPs and decreased TBR2-positive intermediate progenitors, indicating impaired neuronal differentiation without affecting cell proliferation or inducing apoptosis .

What are VLPs and why are they suitable for displaying membrane proteins like GPR157?

Virus-like particles (VLPs) are structures formed by self-assembly of envelope or capsid proteins from viruses, mimicking the repetitive structure of native viral particles while lacking the viral genome. VLPs provide an excellent platform for displaying membrane proteins because they concentrate conformationally intact membrane proteins directly on the cell surface and produce soluble, high-concentration proteins . The size of VLPs (100-300 nm diameter) makes them optimal targets for dendritic cells in vivo and suitable for surface attachment applications . Additionally, VLPs maintain proteins in their native cellular membrane environment, preserving proper folding and functional integrity that might be lost in other recombinant systems .

How does the structural configuration of GPR157 change when incorporated into VLPs?

When GPR157 is incorporated into VLPs, it maintains its native conformation within the lipid bilayer of the particle. The methodology preserves the critical structural elements necessary for GPR157 function, particularly the transmembrane domains and extracellular loops involved in ligand binding. Unlike solubilized GPCR preparations, GPR157-VLPs present the receptor in a membrane environment that closely mimics its natural state. This structural preservation is particularly important for maintaining the receptor's ability to couple with Gq proteins and activate downstream IP3-mediated signaling cascades that are essential for its biological function in neuronal differentiation .

Production and Purification Methods

Effective production of GPR157-VLPs requires careful consideration of expression systems and purification strategies. The choice of production platform significantly impacts yield, quality, and functionality of the final product, with various cell types offering distinct advantages for different research applications.

What expression systems are most effective for producing recombinant GPR157-VLPs?

Multiple expression systems can be utilized for producing recombinant GPR157-VLPs, each with distinct advantages. Mammalian cell systems, particularly HEK293 cells, often provide the most native post-translational modifications and protein folding environment for human GPCRs like GPR157. For VLP production, mammalian cells allow constituting membrane proteins in-situ with VLPs produced directly from the cell culture . Alternatively, insect cells using baculovirus-mediated expression offer high protein yields while maintaining proper protein folding. Yeast and plant expression systems provide cost-effective alternatives that can be scaled up more easily .

When selecting an expression system, researchers should consider: (1) required post-translational modifications, (2) yield requirements, (3) downstream purification complexity, and (4) intended application. For functional studies requiring native receptor activity, mammalian systems typically yield GPR157-VLPs with superior signaling capabilities, while insect cell systems may provide higher yields for structural studies .

How can researchers optimize GPR157 incorporation efficiency into VLPs?

Optimizing GPR157 incorporation into VLPs requires strategic approaches addressing both expression and assembly phases. The process begins with designing appropriate fusion constructs that facilitate GPR157 integration into the VLP structure without compromising receptor functionality. Co-expression of GPR157 with viral structural proteins at balanced ratios is critical, as excess GPR157 can disrupt proper VLP assembly while insufficient expression reduces incorporation efficiency.

For experimental optimization, researchers should systematically vary: (1) the ratio of GPR157 to VLP structural protein expression vectors, (2) expression timing, allowing structural proteins to initiate assembly before introducing GPR157, (3) temperature conditions during expression, with lower temperatures (28-30°C) often improving proper folding, and (4) membrane composition through lipid supplementation to match GPR157's native environment. Quantification of incorporation efficiency can be performed using western blotting of purified VLPs, comparing GPR157 signal to VLP structural proteins, and functional assessment through binding or signaling assays .

What purification challenges are specific to GPR157-VLPs and how can they be addressed?

Purification of GPR157-VLPs presents several challenges due to their complex structure combining lipid membranes, viral proteins, and integrated GPCRs. The primary challenges include: (1) separating fully-assembled GPR157-VLPs from cellular debris and incomplete assemblies, (2) maintaining receptor conformation during purification, and (3) achieving adequate purity without compromising yield.

To address these challenges, researchers should implement a multi-stage purification strategy: Begin with clarification of culture supernatant through low-speed centrifugation (1,000-3,000g) to remove cells and large debris. Follow with ultracentrifugation through a 20% sucrose cushion (100,000g for 2-3 hours) to pellet VLPs while leaving soluble proteins in the supernatant. Further purify using either density gradient ultracentrifugation or size-exclusion chromatography to separate VLPs from exosomes and other vesicles. Throughout purification, maintain physiological pH (7.2-7.4) and include stabilizing agents such as trehalose to prevent freeze-thaw damage . For optimal results, verify GPR157-VLP integrity after purification using dynamic light scattering to confirm appropriate size distribution (mean peak radius of 55-75 nm) and functional assays to ensure receptor activity.

Functional Characterization

Understanding the functional properties of GPR157-VLPs requires specialized assays and experimental approaches that address both receptor activity and VLP characteristics. This section focuses on methodological approaches for investigating GPR157 signaling in the VLP context.

How can researchers assess GPR157 signaling functionality when presented on VLPs?

Assessing GPR157 signaling functionality on VLPs requires approaches that can detect Gq-protein coupling and downstream IP3-mediated calcium signaling. A comprehensive assessment should incorporate multiple complementary techniques. Researchers can implement calcium flux assays using fluorescent calcium indicators (Fluo-4 AM or Fura-2) to measure intracellular calcium changes in cells exposed to GPR157-VLPs. This approach can be enhanced by pre-treating cells with IP3 receptor antagonists to confirm specificity .

For direct measurement of Gq-protein activation, researchers should employ [35S]GTPγS binding assays with purified Gq proteins in the presence of GPR157-VLPs. Additionally, downstream signaling can be assessed through phospholipase C activation assays measuring IP3 production using commercially available ELISA-based detection kits. To demonstrate that the observed signaling is specific to GPR157, researchers should include control experiments using VLPs lacking GPR157 or incorporating GPR157 with mutations in the Gq-coupling domain. Quantitative comparison between GPR157-VLPs and cellular membrane preparations containing GPR157 can provide valuable insight into how the VLP environment affects receptor functionality .

What methods are effective for identifying potential ligands for the orphan receptor GPR157 when displayed on VLPs?

Identifying ligands for orphan GPCRs like GPR157 when displayed on VLPs requires systematic screening approaches that leverage the advantages of the VLP display system. Researchers should implement a multi-tiered strategy beginning with bioinformatic analysis to identify candidate ligands based on structural homology with known GPCR ligands and analyzing the composition of cerebrospinal fluid (CSF), which contains putative ligands for GPR157 .

For experimental screening, researchers can immobilize GPR157-VLPs on sensor chips for surface plasmon resonance (SPR) analysis to detect direct binding of candidate molecules. This approach allows for quantification of binding kinetics and affinity. Functional screening can be performed using calcium mobilization assays in reporter cells exposed to GPR157-VLPs in the presence of candidate ligands. Researchers should develop a library of tissue extracts (particularly from neural tissue) and fractionated biological fluids for systematic screening.

For confirmation of identified hits, dose-response curves should be generated using both binding and functional assays, and specificity should be validated using competitive binding with structurally related compounds. The VLP format provides advantages for ligand screening by maintaining GPR157 in its native conformation and allowing for high-density display that may enhance detection of weak interactions .

How do different cell production systems impact the functional properties of GPR157-VLPs?

The choice of cell production system significantly impacts the functional properties of GPR157-VLPs through differences in post-translational modifications, lipid composition, and protein folding machinery. Comprehensive studies comparing mammalian, insect, yeast, and plant expression systems have revealed distinct functional profiles for resulting VLPs .

Mammalian cell-derived GPR157-VLPs (particularly from HEK293 cells) typically exhibit the most native-like receptor functionality due to proper glycosylation patterns and lipid environment matching human tissues. These preparations show the highest affinity for human Gq proteins and downstream signaling efficiency. Insect cell-derived GPR157-VLPs often yield higher protein expression levels but may display altered glycosylation patterns that can modify ligand binding properties. Yeast systems produce GPR157-VLPs with diminished signaling capacity due to differences in membrane composition and glycosylation, though they maintain basic binding functionality .

Advanced Research Applications

GPR157-VLPs offer significant potential for advanced applications spanning multiple disciplines. This section addresses sophisticated research strategies that leverage the unique properties of these molecular constructs.

How can GPR157-VLPs be used to study neuronal differentiation mechanisms in vitro and in vivo?

GPR157-VLPs provide a powerful tool for studying neuronal differentiation mechanisms by allowing controlled presentation of this receptor in experimental systems. For in vitro studies, researchers can apply GPR157-VLPs to neural progenitor cultures to investigate receptor-mediated effects on differentiation pathways. This approach circumvents the need for genetic manipulation of the progenitors themselves, allowing observation of acute signaling effects.

When designing these experiments, researchers should establish concentration-response relationships by treating neural progenitors with varying concentrations of GPR157-VLPs (typically 1-100 μg/ml) and quantifying differentiation markers such as TBR2 and PAX6 through immunofluorescence and flow cytometry . Time-course analyses (6-72 hours) should be performed to distinguish between immediate signaling events and downstream transcriptional changes. The specificity of GPR157-mediated effects can be confirmed using VLPs incorporating mutant GPR157 lacking Gq-coupling ability or by pharmacologically inhibiting downstream IP3 signaling .

For in vivo applications, GPR157-VLPs can be administered to developing brain tissue through direct injection or implantation of slow-release delivery systems. When combined with electroporation of fluorescent reporters to track affected cells, this approach allows for precise analysis of how GPR157 signaling influences neurogenesis in the intact developing brain. Comparative studies between VLP-delivered GPR157 and in utero knockdown/overexpression approaches provide complementary insights into receptor function .

What structural analysis techniques are most informative for characterizing GPR157-VLPs, and what challenges must be overcome?

Structural characterization of GPR157-VLPs requires a multi-technique approach addressing both VLP architecture and GPCR conformation. Cryo-electron microscopy (cryoEM) represents the gold standard method, capable of achieving resolutions of 2.8-3.5Å for well-ordered VLPs . This technique allows visualization of both the VLP scaffold and the incorporated GPR157 molecules, though heterogeneity in receptor orientation often limits resolution of GPCR structural details.

When implementing cryoEM for GPR157-VLPs, researchers should optimize sample purity and homogeneity through careful purification and potentially introduce stabilizing ligands if available. Image processing should employ focused classification approaches to address VLP heterogeneity. Complementary techniques include negative-stain electron microscopy for initial characterization (achieving 15-20Å resolution), dynamic light scattering to confirm size distribution (expected mean radius 55-75nm), and small-angle X-ray scattering (SAXS) for solution-state structural information .

Key challenges include: (1) distinguishing GPR157 density from the VLP scaffold, which can be addressed by comparing with control VLPs lacking the receptor; (2) receptor orientation heterogeneity, which may be improved by incorporating alignment tags; and (3) maintaining sample integrity during grid preparation. For functional insights, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes in GPR157 upon ligand binding or G-protein interaction when incorporated into VLPs .

How might GPR157-VLPs contribute to therapeutic development for neurological disorders?

GPR157-VLPs hold significant potential for therapeutic development targeting neurological disorders through multiple mechanisms. Since GPR157 signaling enhances neuronal differentiation of radial glial progenitors , engineered GPR157-VLPs could potentially promote neurogenesis in conditions characterized by neuronal loss or impaired neuronal development.

For therapeutic applications, researchers should develop GPR157-VLPs with enhanced stability and targeting capabilities. This requires: (1) engineering the VLP scaffold for extended circulation time and reduced immunogenicity through PEGylation or incorporation of CD47 "don't-eat-me" signals; (2) adding brain-targeting motifs such as transferrin receptor-binding peptides to enhance blood-brain barrier penetration; and (3) incorporating stabilizing mutations in GPR157 to maintain functionality under physiological conditions .

Preclinical development would progress through in vitro neural stem cell models to assess neurogenic capacity, followed by studies in relevant animal models of neurodevelopmental disorders or neurodegenerative conditions. Researchers must thoroughly characterize the immunogenic properties of GPR157-VLPs, as VLPs are inherently immunostimulatory . This dual nature could be advantageous when designing therapeutic vaccines against neurological targets but must be carefully controlled for direct neurogenic applications. Safety assessment should include evaluation of uncontrolled proliferation risks and ectopic neurogenesis when stimulating GPR157 pathways systemically .

Data Analysis and Interpretation Challenges

Working with GPR157-VLPs presents unique data analysis challenges that researchers must navigate to generate reliable and reproducible results. This section addresses key considerations for experimental design and data interpretation.

How can researchers distinguish GPR157-specific effects from general VLP-induced cellular responses?

Distinguishing GPR157-specific effects from general VLP-induced responses requires rigorous experimental design with appropriate controls. Researchers should implement a comprehensive control system including: (1) "empty" VLPs lacking GPR157 but otherwise identical in composition; (2) VLPs displaying a non-signaling mutant GPR157 with disrupted G-protein coupling; and (3) VLPs displaying an unrelated GPCR from a different signaling pathway.

Statistical analysis should employ two-way ANOVA to separate GPR157-specific effects from VLP-mediated effects, with post-hoc tests to identify specific differences between treatment groups. Dose-response experiments are essential, as true receptor-mediated effects typically show characteristic concentration-dependent responses, while non-specific effects often exhibit linear or threshold responses .

For mechanistic confirmation, researchers should implement pathway-specific inhibitors targeting the Gq-IP3-calcium cascade associated with GPR157 signaling. If the observed effects are GPR157-specific, they should be blocked by these inhibitors when applied to GPR157-VLP treatments but not affected when applied to control VLP treatments. Time-course analysis can provide additional discrimination, as receptor-mediated signaling typically follows predictable temporal patterns distinct from general cellular responses to particulate materials .

What statistical approaches are most appropriate for analyzing heterogeneous GPR157-VLP preparations?

Analyzing heterogeneous GPR157-VLP preparations requires statistical approaches that account for particle variability in size, receptor density, and functional activity. Researchers should implement hierarchical mixed-effects models that can distinguish between variation sources (within-batch vs. between-batch variability) while testing treatment effects.

For characterization data, researchers should report complete size distributions rather than simple means, using probability density functions or cumulative distribution plots. When comparing GPR157-VLP batches, Kolmogorov-Smirnov tests provide more appropriate comparison of distribution shapes than standard t-tests. For functional data, researchers should consider employing bootstrap resampling methods to generate robust confidence intervals that don't assume normality .

Quality control metrics should include coefficients of variation for key parameters (size, receptor density, activity) with acceptance thresholds established during assay validation. Multivariate analysis techniques such as principal component analysis can help identify relationships between physical characteristics and functional outcomes across multiple batches. When designing experiments, power analysis should account for the typically higher variability of VLP preparations compared to soluble proteins, often requiring increased sample sizes to achieve equivalent statistical power .

How should researchers interpret contradictory findings between GPR157 studies using VLPs versus other expression systems?

When encountering contradictory findings between GPR157 studies using VLPs versus other expression systems (such as cell-based overexpression or in vivo models), researchers should implement a systematic reconciliation framework. First, examine methodological differences that might explain discrepancies: VLPs present GPR157 in a native-like membrane environment that preserves conformation but lacks cellular machinery found in whole-cell systems .

Contradictions in binding or signaling data might reflect differences in receptor density, membrane composition, or post-translational modifications between systems. Researchers should quantitatively compare receptor density and glycosylation patterns across platforms. For functional discrepancies, examine whether cellular compensation mechanisms might be present in whole-cell or in vivo models but absent in VLP systems .

To resolve contradictions, consider whether the systems are measuring the same parameters or different aspects of GPR157 biology. Design bridging experiments that incrementally increase system complexity (from VLPs to reconstituted membrane systems to cellular models) to identify where discrepancies emerge. Finally, consider whether contradictory findings actually represent complementary aspects of GPR157 function that vary with cellular context or developmental stage .

Experimental Troubleshooting

Successfully working with GPR157-VLPs requires addressing common experimental challenges. This section provides practical guidance for troubleshooting key issues encountered in GPR157-VLP research.

How can researchers address poor expression or incorporation of GPR157 into VLPs?

Poor GPR157 expression or incorporation into VLPs is a common challenge that can significantly impact experimental outcomes. To systematically address this issue, researchers should first optimize the GPR157 construct by: (1) codon-optimizing the sequence for the expression system being used; (2) incorporating a cleavable signal peptide to enhance membrane targeting; and (3) considering fusion tags that facilitate proper folding without interfering with function.

For expression optimization, researchers should test multiple growth conditions, varying temperature (typically lowering to 28-30°C during induction phase), induction timing and duration, and media composition. Adding chemical chaperones such as 4-phenylbutyric acid (5-10 mM) or DMSO (1-2%) during expression can improve GPCR folding. For mammalian expression systems, sodium butyrate (5-10 mM) can enhance protein expression by inhibiting histone deacetylases .

If GPR157 expresses well but incorporation into VLPs is poor, researchers should adjust the timing of expression, ensuring VLP structural proteins are expressed before or simultaneously with GPR157. Modifying the lipid composition by supplementing with cholesterol or specific phospholipids can enhance incorporation of GPCRs like GPR157 into forming VLPs. Finally, creating fusion constructs that link GPR157 to VLP structural proteins through flexible linkers can force incorporation, though this approach requires careful validation of receptor functionality .

What are the most effective strategies for stabilizing GPR157-VLPs during storage and experimental manipulation?

Stabilizing GPR157-VLPs requires addressing both the structural integrity of the VLP scaffold and maintaining the native conformation of the incorporated GPR157 receptor. Researchers should implement a multi-faceted stabilization approach beginning with buffer optimization: PBS supplemented with 5-10% trehalose and 1-5 mM arginine at pH 7.4 provides excellent base stability for VLPs .

Temperature management is critical, with GPR157-VLPs being most stable when stored at -80°C with minimal freeze-thaw cycles. If multiple uses are planned, prepare single-use aliquots rather than repeatedly freezing and thawing the same stock. For short-term storage (1-2 weeks), 4°C is preferable to freezing and thawing. If available, specific ligands for GPR157 or general GPCR stabilizing compounds can significantly enhance receptor stability when added to storage buffers .

Physical stabilization techniques include: (1) adding non-ionic detergents below their critical micelle concentration (0.01-0.05% Pluronic F-127) to prevent particle aggregation; (2) chemical crosslinking using low concentrations of glutaraldehyde (0.05-0.1%) for applications where receptor functionality is not required; and (3) lyophilization in the presence of appropriate cryoprotectants for long-term ambient storage. Researchers should validate that GPR157 retains functionality after storage using binding assays or functional calcium mobilization experiments .

What techniques can help overcome poor reproductibility in GPR157-VLP functional assays?

Poor reproducibility in GPR157-VLP functional assays often stems from variability in VLP preparation, assay conditions, and cellular responses. Researchers can implement several techniques to enhance reproducibility throughout the experimental workflow. For VLP production, establish stringent quality control metrics including size distribution analysis by dynamic light scattering (acceptable polydispersity index <0.2), receptor density quantification by quantitative western blotting, and functional activity assessment through standardized signaling assays .

During assay preparation, precise quantification of VLP concentration is essential - researchers should use protein assays in combination with particle counting methods like nanoparticle tracking analysis rather than relying solely on protein concentration. Functional assays should include internal standards run alongside experimental samples in each assay plate to normalize for day-to-day variability .

For cell-based assays, maintaining consistent cell culture conditions is critical: use cells within a narrow passage range, standardize cell density and culture duration before assays, and implement automated liquid handling where possible to reduce operator variability. When measuring calcium responses to GPR157-VLPs, pre-incubate cells with calcium indicator dyes under precisely controlled conditions (time, temperature, dye concentration) and include calibration controls for maximum and minimum calcium signals .

Data analysis should implement normalization procedures that account for batch effects and use robust statistical methods such as median-based analyses that are less sensitive to outliers. Finally, researchers should develop detailed standard operating procedures documenting every step of the experimental workflow and implement a systematic approach to troubleshooting when reproducibility issues arise .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.