Recombinant Human G-protein coupled receptor 161 (GPR161)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant GPR161 is produced using diverse expression systems:

Table 1: Expression Systems and Applications

HostResidue RangeTagApplicationsSource
Wheat germ362–460NoneELISA, Western blot (WB)
Escherichia coli1–28 (extracellular)GSTAntibody production, cancer studies
HEK-293 cells1–529Strep/HisStructural studies, signaling assays
Tobacco (N. tabacum)1–529StrepHigh-yield synthesis, functional studies

The E. coli-derived extracellular fragment (residues 1–28) is frequently used for monoclonal antibody development in triple-negative breast cancer research .

Hedgehog Pathway Regulation

  • Neural tube development: GPR161 knockout mice exhibit embryonic lethality by E10.5 due to ventral progenitor expansion .

  • Limb bud patterning: Ciliary GPR161 pools prevent polydactyly by maintaining GLI3R levels .

Cancer Biology

  • Triple-negative breast cancer (TNBC): GPR161 overexpression correlates with poor prognosis and promotes metastasis . Recombinant extracellular domains enable antibody-based therapeutic exploration .

Table 2: Phenotypic Outcomes of GPR161 Mutations

MutationEffect on Hh SignalingDevelopmental Defect
Ciliary localization-defective (mut1)Partial GLI3R loss, midface wideningDelayed embryonic lethality
Sterol-binding mutantsReduced cAMP production, impaired PKA activityNeural tube patterning defects
Full knockoutComplete GLI3R loss, ventral neural expansionEmbryonic lethality by E10.5

Biochemical Properties

  • Molecular weight: ~58–60 kDa (varies by construct) .

  • Post-translational modifications: Phosphorylation attenuates signaling .

  • Storage: Stable at -80°C; sensitive to freeze-thaw cycles .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order remarks. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Typically, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize development accordingly.
Synonyms
GPR161; G-protein coupled receptor 161; G-protein coupled receptor RE2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-529
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVTLYKKSYLLT LSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGV IAIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVA AWHREPGYTAFWQIWCALFPFLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRK NSSTSTSSSGSRRNAFQGVVYSANQCKALITILVVLGAFMVTWGPYMVVIASEALWGKSS VSPSLETWATWLSFASAVCHPLIYGLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFS ISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSH CTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFG EEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLAAEQR
Uniprot No.

Target Background

Function
GPR161 is a key negative regulator of Shh signaling, promoting the processing of GLI3 into GLI3R during neural tube development. It is recruited by TULP3 and the IFT-A complex to primary cilia, functioning as a regulator of the PKA-dependent basal repression machinery in Shh signaling. This occurs by increasing cAMP levels, leading to the promotion of PKA-dependent processing of GLI3 into GLI3R and subsequent repression of Shh signaling. In the presence of SHH, GPR161 is removed from primary cilia and internalized into recycling endosomes, preventing its activity and allowing activation of Shh signaling. The ligand for GPR161 is currently unknown.
Gene References Into Functions
  1. GPR161 is a crucial factor in the basal suppression machinery of Shh signaling, playing a critical role in neural tube morphogenesis and closure. (Review) PMID: 27731925
  2. GPR161 is an A-kinase anchoring protein, and the cAMP-sensing GPR161:PKA complex acts as a cilium-compartmentalized signalosome PMID: 27357676
  3. Smoothened determines beta-arrestin-mediated removal of the G protein-coupled receptor GPR161 from the primary cilium. PMID: 27002170
  4. G-protein-coupled receptor GPR161 is overexpressed in breast cancer and is a promoter of cell proliferation and invasion. PMID: 24599592
  5. False positive non-synonymous polymorphisms of G-protein coupled receptor genes. PMID: 11959142

Show More

Hide All

Database Links

HGNC: 23694

OMIM: 612250

KEGG: hsa:23432

STRING: 9606.ENSP00000271357

UniGene: Hs.271809

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of GPR161 in cellular signaling?

GPR161 functions as a key negative regulator of Sonic hedgehog (Shh) signaling by promoting the processing of GLI3 into its repressor form GLI3R during neural tube development. The protein is recruited by TULP3 and the IFT-A complex to primary cilia where it acts as a regulator of the PKA-dependent basal repression machinery in Shh signaling. GPR161 increases cAMP levels, which promotes the PKA-dependent processing of GLI3 into GLI3R, thereby repressing Shh signaling . In the presence of SHH, GPR161 is removed from primary cilia and internalized into recycling endosomes, preventing its activity and allowing activation of Shh signaling .

How does GPR161 relate to neural tube development?

GPR161 plays a crucial role in neural tube patterning by regulating Hedgehog (Hh) signaling. Knockout studies in mice have shown that Gpr161-deficient embryos are embryonic lethal by embryonic day 10.5 (E10.5) and exhibit increased Hh signaling with expansion of ventral progenitors throughout the rostrocaudal extent of the neural tube . The loss of GPR161 prevents sufficient Gli3R processing required to inhibit ventral expansion of Nkx6.1 in the intermediate neural tube . Recently, GPR161 mutations have been reported in patients suffering from caudal neural tube defects, including spina bifida .

What molecular mechanisms does GPR161 employ to regulate the Hedgehog pathway?

GPR161 regulates the Hedgehog pathway through cAMP-PKA signaling. As an orphan G-protein-coupled receptor with constitutive activity, GPR161 generates cAMP without requiring a ligand . This cAMP production activates Protein Kinase A (PKA), which phosphorylates Gli transcription factors, particularly Gli3, promoting its processing into the repressor form (Gli3R) . GPR161 has been shown to directly bind to type I PKA regulatory subunits through its C-tail, facilitating PKA activation in proximity to Gpr161-mediated cAMP production in cilia for GliR processing . This mechanism establishes a basal repression of Hedgehog signaling in the absence of Shh ligand.

How do ciliary and extraciliary pools of GPR161 differentially contribute to Hedgehog pathway regulation?

Research has demonstrated that both ciliary and extraciliary pools of GPR161 cumulatively contribute to Gli3R processing, with distinct functional outcomes. In mouse embryos expressing the ciliary localization defective Gpr161 mutant (Gpr161 mut1/mut1), higher extraciliary pools increased Gli3R processing compared to Gpr161 mut1/ko embryos at E9.5 . Despite both pools contributing to Gli3R processing, neural tube ventralization in mut1/ko Gpr161 appears completely dependent on cilia.

What structural features of GPR161 account for its constitutive activity?

Recent structural studies of GPR161 have revealed unique conformational features that may explain its constitutive activity. Analysis of the GPR161-Gs complex structure at 2.7 Å resolution shows that GPR161 adopts an active conformation similar to other activated Class A GPCRs bound to heterotrimeric G proteins . A key hallmark of this activation is the outward displacement of transmembrane helix 6 (TM6) to accommodate the C-terminal α-helix of the Gα subunit .

Notably, GPR161 exhibits a unique conformation of extracellular loop 2 (ECL2) compared to most ligand-activated Class A GPCRs. The ECL2 forms a beta hairpin that folds over the extracellular face of the receptor, completely occluding the canonical orthosteric ligand binding pocket . This unusual structure is stabilized by:

  • A distributed set of hydrophobic contacts between the deep portion of ECL2 and GPR161

  • Ionic interactions between D172/K175 in ECL2 and E293/K298 in ECL3

This structural arrangement suggests that GPR161 may have evolved to maintain constitutive activity without requiring an extracellular ligand, potentially explaining its ability to generate cAMP signaling in the absence of a known stimulator.

What methodologies are most effective for studying GPR161 localization and trafficking in primary cilia?

Studying GPR161 localization and trafficking in primary cilia requires specialized techniques that preserve ciliary structure while allowing for specific protein detection. Effective methodologies include:

  • Immunofluorescence microscopy with ciliary markers: Co-staining with ciliary markers like acetylated tubulin or ARL13B alongside GPR161 antibodies allows visualization of receptor localization within cilia. For quantitative analysis, measuring the fluorescence intensity ratio of GPR161 within cilia versus cytoplasm provides a reliable metric.

  • Live-cell imaging with fluorescently tagged GPR161: Creating stable cell lines expressing GPR161 fused to fluorescent proteins (e.g., GFP, mCherry) enables real-time tracking of receptor movement in response to Hedgehog pathway manipulation. Care must be taken to ensure fusion proteins maintain normal localization and function.

  • Biochemical fractionation of ciliary membranes: Isolation of ciliary versus non-ciliary membrane fractions followed by Western blotting can quantitatively assess GPR161 distribution between compartments. This approach requires careful validation to ensure clean separation of cellular compartments.

For trafficking studies specifically, pulse-chase experiments using photo-convertible fluorescent tags or inducible expression systems can reveal the kinetics of GPR161 movement into or out of cilia in response to Shh pathway activation or inhibition.

What are the optimal cell models for studying GPR161 function in Hedgehog signaling?

When selecting cell models for GPR161 research, several factors should be considered:

  • NIH3T3 cells: These mouse fibroblasts have been widely used for Hedgehog pathway studies as they form primary cilia upon serum starvation and respond robustly to Shh stimulation. They express endogenous GPR161 and other pathway components, making them suitable for loss-of-function and overexpression studies.

  • Neural progenitor cells: Since GPR161 plays a critical role in neural tube development, primary neural progenitors or neural stem cell lines provide a physiologically relevant context. These cells maintain ciliary signaling and exhibit appropriate dorsal-ventral patterning responses.

  • IMCD3 cells: These kidney epithelial cells form prominent primary cilia and are amenable to gene editing approaches, making them useful for studying GPR161 trafficking and localization.

For studies requiring a system that normally lacks Hedgehog signaling, HEK293 cells (which are non-ciliated) have been used successfully after GPR161 fusion with a minimal version of the Gαs protein to stabilize the receptor in its active state . This approach enabled structural studies of GPR161 and may be valuable for biochemical analyses.

The choice between these models should be guided by the specific research question, with consideration for whether endogenous Hedgehog pathway components are required and whether ciliary localization is central to the experimental hypothesis.

How can researchers effectively generate and validate GPR161 knockout or mutant models?

Creating reliable GPR161 knockout or mutant models requires careful consideration of both technical approaches and validation strategies:

Generation Approaches:

  • CRISPR-Cas9 genome editing: This is currently the preferred method for creating precise GPR161 mutations or knockouts. When designing guide RNAs, target early exons to ensure complete loss of function, and consider multiple guides to increase efficiency. For specific mutations (like those found in human diseases), homology-directed repair with appropriate donor templates is recommended.

  • Conditional knockout strategies: Since complete Gpr161 knockout is embryonic lethal in mice, tissue-specific or inducible knockout strategies using Cre-loxP or similar systems are essential for studying GPR161 function in specific developmental contexts or adult tissues.

  • Point mutations: For studying specific aspects of GPR161 function, introducing targeted mutations can be more informative than complete knockouts. For example, mutation of ciliary localization signals (as in the Gpr161 mut1 model) allowed researchers to distinguish between ciliary and extraciliary functions .

Validation Strategies:

  • Genomic verification: Confirm mutations by sequencing the target locus.

  • Protein expression analysis: Verify loss of GPR161 protein by Western blotting and immunofluorescence.

  • Functional validation: Assess Hedgehog pathway activity by measuring Gli transcription factor processing (particularly Gli3R formation) and expression of Hedgehog target genes (e.g., Ptch1, Gli1).

  • Phenotypic characterization: Compare phenotypes to known GPR161 loss-of-function models. For neural tube development, examine dorsal-ventral patterning markers like FoxA2, Nkx6.1, Pax6, and Pax7 .

  • Rescue experiments: Reintroduce wild-type or mutant GPR161 to confirm specificity of observed phenotypes.

What are the critical parameters for assessing GPR161-mediated cAMP signaling in experimental systems?

Accurately measuring GPR161-mediated cAMP signaling requires attention to several critical parameters:

Assay Selection:

  • TR-FRET cAMP assays: Time-resolved fluorescence resonance energy transfer assays using lanthanide fluorophores provide high sensitivity with minimal background interference. These assays have been successfully employed to measure constitutive cAMP signaling by GPR161 . The key advantage is their ability to eliminate background noise through time-resolved detection that minimizes prompt intrinsic fluorescence interferences.

  • FRET-based biosensors: Live-cell compatible biosensors like EPAC-based sensors allow real-time monitoring of cAMP dynamics in specific subcellular compartments, which is particularly valuable for distinguishing ciliary versus cytoplasmic cAMP pools.

Critical Controls and Parameters:

  • Temporal considerations: cAMP responses can be transient, so establishing appropriate time courses is essential.

  • Subcellular compartmentalization: Since GPR161 generates cAMP signals in distinct cellular compartments, methods that can resolve spatial differences in signaling (such as targeted biosensors) provide more complete information.

  • Expression level normalization: When comparing wild-type GPR161 to mutant variants, ensure comparable expression levels, as differences in protein abundance can confound interpretation of signaling activity.

  • Phosphodiesterase inhibitors: Consider whether to include inhibitors like IBMX, recognizing that they will alter the temporal dynamics of cAMP signaling.

  • Positive controls: Include forskolin treatment (direct activator of adenylyl cyclases) as a positive control for cAMP production capacity.

  • Downstream pathway activation: Measure PKA activity through substrate phosphorylation (such as CREB) to confirm functional consequences of cAMP production.

How do GPR161 mutations contribute to medulloblastoma development?

Germline GPR161 mutations have been identified as predisposing factors for pediatric medulloblastoma, particularly in infants with a median age of 1.5 years . These mutations are exclusively associated with the sonic hedgehog medulloblastoma (MB SHH) subgroup and account for approximately 5% of infant MB SHH cases .

Molecular tumor profiling has revealed several key characteristics of GPR161-associated medulloblastomas:

  • Loss of heterozygosity (LOH) at the GPR161 locus in all affected MB SHH tumors

  • Atypical somatic copy number landscapes

  • No additional somatic driver events

Analysis of 226 MB SHH tumors identified somatic copy-neutral loss of heterozygosity of chromosome 1q as the hallmark characteristic of GPR161 deficiency. This represents the primary mechanism for biallelic inactivation of GPR161 in affected MB SHH tumors .

Mechanistically, loss of GPR161 function likely promotes medulloblastoma development through constitutive activation of the Hedgehog pathway. Without GPR161's repressive effect on Hedgehog signaling, there is insufficient processing of Gli transcription factors into their repressor forms, leading to inappropriate pathway activation and oncogenic transformation of cerebellar granule neuron precursors.

What methodological approaches are most effective for studying GPR161's role in neural tube defects?

Neural tube defects (NTDs) associated with GPR161 dysfunction require specialized approaches spanning from molecular to organismal levels:

In Vivo Models:

  • Conditional knockout models: Since complete Gpr161 knockout is embryonic lethal, tissue-specific or temporally controlled deletion using Cre-loxP systems allows study of GPR161 function at specific developmental stages. These models can reveal how GPR161 interacts with other signaling pathways involved in neural tube closure.

  • Hypomorphic alleles: Creating mouse models with reduced but not absent GPR161 function can mimic the partial loss-of-function that might occur in human patients, potentially allowing animals to survive longer for phenotypic analysis.

Analytical Approaches:

  • Immunohistochemical analysis of neural tube sections: Examine expression of dorsal-ventral patterning markers including:

    • FoxA2 (floor plate marker)

    • Nkx6.1 (ventral progenitor marker)

    • Pax6 and Pax7 (dorsal markers)

  • Whole-mount in situ hybridization: Assess spatial expression patterns of Hedgehog target genes during neural tube development.

  • Live imaging of neural tube closure: Monitor the dynamic process of neural fold elevation, apposition, and fusion in embryo culture systems.

  • Cross-pathway analysis: Examine how GPR161 interacts with other pathways implicated in neural tube closure, including Wnt and BMP signaling, which have been shown to cross-regulate with Hedgehog signaling during neural tube development .

  • Human genetic studies: Screen NTD patients for GPR161 variants and correlate genotypes with specific phenotypes to establish genotype-phenotype relationships.

How might pharmacological modulation of GPR161 be developed as a therapeutic strategy?

While GPR161 represents a promising therapeutic target, several challenges and considerations must be addressed:

Potential Therapeutic Approaches:

  • Small molecule modulators: Developing compounds that could either:

    • Enhance GPR161 activity to suppress inappropriate Hedgehog signaling in medulloblastoma or other Hedgehog-driven cancers

    • Inhibit GPR161 activity in specific contexts where increased Hedgehog signaling might be beneficial

  • Ciliary localization modulators: Compounds that specifically alter GPR161 trafficking to or from cilia could provide a more nuanced approach to modulating Hedgehog signaling compared to direct pathway inhibitors like Smoothened antagonists.

Technical and Conceptual Challenges:

  • Receptor structure considerations: The unique structure of GPR161, particularly its occluded canonical ligand binding pocket formed by the ECL2 beta hairpin , presents challenges for conventional GPCR-targeted drug design. Alternative approaches targeting allosteric sites may be necessary.

  • Constitutive activity: As GPR161 displays constitutive activity without a known ligand , designing inhibitors may require approaches different from competitive antagonism used for ligand-activated GPCRs.

  • Ciliary targeting: Developing compounds that can access the ciliary compartment where GPR161 functions presents additional pharmaceutical challenges.

  • Cellular context specificity: Since GPR161 has distinct functions in different cellular contexts, achieving tissue-specific modulation would be critical to avoid unintended effects.

What expression systems are optimal for producing functional recombinant GPR161 protein?

The choice of expression system significantly impacts the yield, functionality, and structural integrity of recombinant GPR161:

Expression Systems Comparison:

  • Wheat germ cell-free system: This system has been successfully used to produce recombinant human GPR161 protein fragments (362-460 aa range) . The advantages include:

    • Eukaryotic translation machinery

    • Absence of membrane insertion challenges for soluble fragments

    • Reduced proteolytic degradation compared to some cellular systems

  • HEK293 cells with fusion partners: For structural studies, GPR161 has been successfully expressed in HEK293 cells C-terminally fused to a minimal version of the Gαs protein ("miniGs") . This approach stabilizes the receptor in its active conformation and increases the likelihood of co-purifying with activating stimuli.

  • Insect cell systems: Baculovirus-infected Sf9 or High Five cells often provide higher yields of properly folded mammalian GPCRs than mammalian systems and include most post-translational modifications.

Critical Considerations:

  • Full-length vs. fragment expression: For functional studies, full-length GPR161 is required, while specific domains may be expressed as fragments for interaction studies or antibody production.

  • Stabilization strategies: As noted in structural studies, GPR161 preparations without a signal transducer were of poor quality, suggesting the receptor alone may be structurally dynamic or unstable . Fusion partners, thermostabilizing mutations, or nanobodies may improve stability.

  • Detergent selection: For membrane-bound full-length GPR161, the choice of detergent during solubilization and purification is critical for maintaining functionality.

What are the most reliable methods to assess GPR161 conformational integrity after purification?

Ensuring purified GPR161 maintains its native conformation is critical for structural and functional studies:

Biophysical Approaches:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content and can detect major conformational changes or denaturation.

  • Thermal shift assays: Measures protein stability by monitoring unfolding as temperature increases. More stable protein preparations typically show higher melting temperatures.

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): Assesses protein monodispersity and oligomeric state, which can be indicators of proper folding.

Functional Verification:

  • G protein coupling assays: Since GPR161 couples to Gs proteins, measuring its ability to activate G proteins using [35S]GTPγS binding or bioluminescence resonance energy transfer (BRET) assays can confirm functional integrity.

  • cAMP production: As GPR161 exhibits constitutive activity leading to cAMP production, measuring cAMP levels using TR-FRET assays when the purified protein is reconstituted in appropriate membrane mimetics can verify functionality .

  • Binding to known interacting partners: Assessing binding to proteins known to interact with GPR161, such as PKA regulatory subunits or TULP3, can provide evidence of proper conformation.

What structural data is currently available for GPR161 and how might it inform experimental design?

Structural information on GPR161 has recently expanded, providing valuable insights for experimental design:

Current Structural Data:

The GPR161-Gs complex structure has been determined at 2.7 Å resolution using cryo-electron microscopy (cryo-EM) . Key technical details from this structure determination include:

ParameterValue
Magnification105,000
Voltage (kV)300
Electron exposure (e–/Å2)50.7
Defocus range (μm)-0.8 to -2.2
Pixel size (Å)0.86
Map resolution (Å)2.7
Model resolution (Å)3.1

Key Structural Features:

  • Active conformation: The structure captures GPR161 in its G-protein coupled, active conformation, with characteristic outward displacement of transmembrane helix 6 (TM6) .

  • Unique ECL2 conformation: Unlike most Class A GPCRs, GPR161's ECL2 forms a beta hairpin that folds over the extracellular face, occluding the canonical orthosteric ligand binding pocket .

  • Interactions stabilizing ECL2: The structure reveals specific hydrophobic contacts and ionic interactions (D172/K175 in ECL2 with E293/K298 in ECL3) that anchor ECL2 in position .

Implications for Experimental Design:

  • Mutagenesis studies: The structure identifies specific residues that may be critical for GPR161 function, providing targets for site-directed mutagenesis to probe structure-function relationships.

  • Drug design approaches: The occluded orthosteric pocket suggests that traditional competitive ligand approaches may be challenging, directing focus toward allosteric modulation strategies.

  • Protein engineering: Understanding the structural basis for GPR161's constitutive activity may inform the design of modified versions with altered signaling properties for research applications.

  • Interaction studies: The structure provides a framework for investigating how GPR161 interacts with other proteins in the Hedgehog signaling pathway, potentially revealing new regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.