Recombinant Human G-protein coupled receptor 1 (GPR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human G-protein coupled receptor 1 (GPR1)

G-protein coupled receptor 1 (GPR1) belongs to the superfamily of G protein-coupled receptors, which constitute the largest class of membrane proteins involved in signal transduction. The human GPR1 gene is identified by gene ID 2825 with NCBI accession number NM_005279 . Originally, GPR1 gained attention as a potential co-receptor for HIV, though subsequent research has expanded our understanding of its physiological roles .

Recombinant Human GPR1 refers to artificially produced versions of this receptor generated through recombinant DNA technology in various expression systems. These recombinant proteins maintain the structural and functional properties of native GPR1 while allowing controlled production for research purposes. The availability of recombinant GPR1 has significantly advanced our understanding of this receptor's biochemistry and biological significance.

GPR1 functions as a receptor for chemerin, a chemoattractant and adipokine protein that regulates multiple biological processes including inflammation and metabolism . The interaction between chemerin and GPR1 triggers specific signaling cascades that influence various cellular functions, making this receptor-ligand pair a subject of increasing scientific interest.

Expression Systems and Production Methods

The production of recombinant human GPR1 employs various expression systems, each offering specific advantages depending on the intended application. The following table summarizes the major expression systems used for GPR1 production:

Expression SystemCharacteristicsAdvantages
Wheat germIn vitro expression with proprietary liposome technologySuitable for full-length protein without tags
E. coliBacterial expressionHigh yield, cost-effective
YeastEukaryotic expressionPost-translational modifications
BaculovirusInsect cell expressionComplex protein folding capacity
Mammalian cellsExpression in human or other mammalian cellsNative-like folding and modifications
Cell-freeIn vitro protein synthesisRapid production, handles toxic proteins

The wheat germ expression system has been successfully employed to produce full-length human GPR1 (corresponding to NP_005270.2) without additional tags . This system yields the recombinant protein in a liquid format, buffered in 25 mM Tris-HCl at pH 8.0 containing 2% glycerol . For optimal stability, manufacturers recommend storage at -80°C and advise against heating the protein before electrophoresis to prevent aggregation .

Regardless of the expression system used, commercially available recombinant GPR1 proteins typically achieve purities of 85% or greater as determined by SDS-PAGE . The choice of expression system depends on the specific requirements of downstream applications, including functional assays, structural studies, or antibody production.

Functional Properties and Signaling Pathways

Recombinant human GPR1 functions as an active receptor for chemerin, initiating specific signaling pathways upon ligand binding. Functional studies have demonstrated that GPR1 primarily signals through the Gi protein pathway, leading to inhibition of adenylyl cyclase and subsequent reduction in cyclic adenosine monophosphate (cAMP) levels .

The functional properties of GPR1 have been characterized using various assays:

  1. cAMP assays: Chemerin has been shown to suppress forskolin-induced cAMP release, an effect that is dose-dependently abolished by treatment with the GPR1 antagonist peptide LRH7-G5 .

  2. Calcium mobilization assays: GPR1 activation leads to intracellular calcium release, which is significantly decreased by LRH7-G5 treatment in GPR1-expressing cells but not in control cells .

  3. β-arrestin recruitment assays: Tango assay systems have been used to measure chemerin receptor activity by assessing β-arrestin recruitment to both GPR1 and CMKLR1 following stimulation with recombinant human chemerin .

These functional analyses confirm that recombinant GPR1 maintains the signaling capabilities of the native receptor, making it a valuable tool for studying GPR1-mediated cellular responses and for screening potential modulators of its activity.

Role in Health and Disease

Research utilizing recombinant GPR1 and related experimental systems has revealed important roles for this receptor in both normal physiology and disease states. GPR1 is expressed in various metabolically active tissues, suggesting its involvement in energy metabolism and homeostasis .

GPR1 in Cancer Biology

GPR1 has been implicated in cancer progression, particularly in breast cancer. Studies have demonstrated significantly elevated GPR1 expression in triple-negative breast cancer (TNBC) tissues and cell lines compared to other subtypes . This finding was supported by analysis of breast cancer cell lines from a public microarray dataset (GSE41313), which confirmed a correlation between GPR1 expression and the basal-like subtype .

The functional significance of GPR1 in TNBC has been investigated using the GPR1 antagonist peptide LRH7-G5, which demonstrated antitumor effects in this aggressive form of breast cancer . These findings suggest that GPR1 regulates TNBC cell proliferation and may represent a promising therapeutic target for basal-like TNBC .

GPR1 in Metabolic Regulation

GPR1 also appears to play a role in metabolic regulation, particularly in glucose homeostasis during obesity. Studies using Gpr1-null mice have provided evidence for GPR1's contribution to metabolic function, especially when animals are challenged with a high-fat diet . Expression analysis has shown that Gpr1 is present in metabolically active tissues, including white adipose tissue (WAT), brown adipose tissue (BAT), skeletal muscle, and liver .

The involvement of GPR1 in both cancer and metabolism highlights the diverse biological functions of this receptor and underscores its potential as a therapeutic target for multiple conditions.

Applications in Research and Therapeutics

Recombinant human GPR1 proteins serve numerous purposes in both basic and applied research, with potential extensions into therapeutic development. The following table summarizes key research findings and their implications:

Research FindingMethodologyImplicationReference
GPR1 elevation in TNBCExpression analysisBiomarker potential
GPR1 antagonist LRH7-G5 inhibits tumor growthCell-based assaysTherapeutic target validation
C9 peptide binding mechanismCryo-EM analysisStructure-based drug design
GPR1-Gi protein couplingFunctional verificationSignaling pathway targeting
GPR1 role in glucose homeostasisKnockout mouse studiesMetabolic disorder applications

Therapeutic Development

The identification of GPR1 as a potential driver of TNBC progression has led to interest in developing GPR1 antagonists as cancer therapeutics. The peptide antagonist LRH7-G5 has shown promise in preclinical studies, suggesting that GPR1 inhibition could represent a novel strategy for treating this aggressive form of breast cancer .

Additionally, the role of GPR1 in glucose homeostasis indicates potential applications in metabolic disorders. Pharmacological targeting of GPR1 might offer new approaches for treating conditions such as obesity and type 2 diabetes, though additional research is needed to fully validate this receptor as a metabolic therapeutic target .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
CMKLR2; GPR1; Chemerin-like receptor 2; Chemerin chemokine-like receptor 2; Chemokine-like receptor 2; G-protein coupled receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVI WFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLN MFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVE FNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILI SSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLN PILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ
Uniprot No.

Target Background

Function
GPR1 functions as a receptor for the chemoattractant adipokine chemerin/RARRES2, suggesting a role in the regulation of inflammation and energy homeostasis. It primarily signals through the beta-arrestin pathway. RARRES2 binding weakly activates G proteins, calcium mobilization, and MAPK1/MAPK3 (ERK1/2) phosphorylation. It also acts as a receptor for TAFA1, mediating its effects on neuronal stem-cell proliferation and differentiation via the activation of ROCK/ERK and ROCK/STAT3 signaling pathways. Additionally, GPR1 serves as a coreceptor for HIV-1.
Gene References Into Functions
  1. CMKLR1 and GPR1 are widely expressed in vascular smooth muscle. PMID: 27742615
  2. Gene-based analyses revealed four significant associations in the WT1, ZC3H12C, DLGAP2, and GPR1 genes at p < 0.05. in this study. PMID: 25391383
  3. The GPR1 gene is imprinted and paternally expressed in humans and mice. PMID: 20385583
  4. Homologous amino acid sequences in amino-terminal regions between CCR5 and GPR1/ sequences are important for G protein-coupled receptors to make the conformation critical for the interaction with the Env protein of HIV-1. PMID: 20334567
  5. GPR1 is a senescence-associated gene in normal human oral keratinocytes. PMID: 12837283
  6. Data indicate that a synthetic peptide derived from the NH2-terminal extracellular region of an orphan GPCR, GPR1, inhibited infection of not only an HIV-1 variant that uses GPR1 as a co-receptor, but also X4, R5, and R5X4 viruses. PMID: 15919664

Show More

Hide All

Database Links

HGNC: 4463

OMIM: 600239

KEGG: hsa:2825

STRING: 9606.ENSP00000384345

UniGene: Hs.184907

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in hippocampus.

Q&A

What is GPR1 and what is its biological function?

GPR1 is a member of the Class B or secretin receptor-like family of G protein-coupled receptors (GPCRs). It functions as a receptor for the chemoattractant adipokine chemerin/RARRES2, suggesting a role in the regulation of inflammation and energy homeostasis . It signals mainly via the beta-arrestin pathway, but binding of RARRES2 also weakly activates G proteins, calcium mobilization, and MAPK1/MAPK3 phosphorylation .

The mature extracellular domain (ECD) of human GPR1 shares significant amino acid identity with mouse and rat GPR1. It is expressed in pancreas, lung, heart, kidney, hypothalamus, and stomach . Recent research has shown that GPR1 is capable of Gi signaling when stimulated with full-length chemerin or its C-terminal nonapeptide (C9, YFPGQFAFS) .

What expression systems are recommended for producing recombinant human GPR1?

Several expression systems can be used to produce recombinant human GPR1:

Expression SystemAdvantagesChallenges
Wheat germCell-free system allows production of difficult membrane proteins; preserves protein functionality Lower yield compared to mammalian systems
Mammalian cells (HEK293, CHO)Native-like post-translational modifications; proper foldingMore expensive; longer production time
E. coliHigh yield; cost-effectiveLacks post-translational modifications; potential inclusion body formation
Insect cellsBetter for GPCRs than bacteria; good yieldsGlycosylation pattern differs from human cells

For functional studies, the wheat germ expression system with proprietary liposome technology has been successfully used to produce full-length human GPR1 (NP_005270.2) without tags . This system is particularly suitable for GPCRs as it can incorporate them directly into liposomes, maintaining their native structure.

How should researchers design experiments to study GPR1 signaling pathways?

When designing experiments to study GPR1 signaling pathways, researchers should follow these methodological steps:

  • Define your variables clearly :

    • Independent variable: GPR1 ligand (e.g., chemerin or C9 peptide concentration)

    • Dependent variable: Measure of receptor activation (e.g., cAMP levels, calcium flux, ERK phosphorylation)

    • Control variables: Cell type, expression levels, temperature, incubation time

  • Select appropriate experimental controls:

    • Positive control: Known GPR1 activator (chemerin)

    • Negative control: Untransfected cells or cells with mutated GPR1

    • Vehicle control: Buffer solution without ligand

  • Choose a suitable receptor activation assay:

    • For Gi protein coupling: cAMP inhibition assay

    • For β-arrestin recruitment: BRET or FRET-based assays

    • For downstream signaling: ERK1/2 phosphorylation assay

  • Implement a robust study design:

    • Dose-response experiments (10^-12 to 10^-6 M ligand)

    • Time-course experiments (30 sec to 60 min post-stimulation)

    • Signal specificity experiments using inhibitors of specific pathways

Remember that the study design should be "the architecture of an experimental study and a description of how the study was conducted, including all elements of how the data were obtained" .

What methods are available for studying GPR1-ligand interactions?

Several complementary techniques can be employed to study GPR1-ligand interactions:

  • Binding assays:

    • Radioligand binding using [125I]-labeled chemerin

    • Fluorescence-based binding assays using fluorescently labeled ligands

    • Surface plasmon resonance (SPR) to measure binding kinetics

  • Structural studies:

    • Cryo-EM has been successfully used to determine the structure of GPR1 bound to chemerin and C9 peptide

    • X-ray crystallography (challenging for GPCRs but possible with stabilizing mutations)

    • NMR for studying specific domains or peptide interactions

  • Computational approaches:

    • Molecular dynamics simulations to analyze binding energetics

    • Free energy landscape estimation by parallel bias metadynamics

    • Molecular docking studies to predict binding poses of novel ligands

  • Site-directed mutagenesis:

    • Alanine scanning mutagenesis to identify critical binding residues

    • Point mutations introduced using homologous recombination

    • Structure-guided mutations based on cryo-EM data

Recent research has employed parallel bias metadynamics simulations to estimate the unbinding free energy landscape of the C-terminus of chemerin in both C9-GPR1 and full-length chemerin-GPR1 complexes , providing valuable insights into the energetics of these interactions.

How does the "two-site" binding model of chemerin to GPR1 work, and what are its implications?

The "two-site" binding model of chemerin to GPR1 represents a sophisticated binding mechanism that has significant implications for drug development. According to recent cryo-EM studies , this model works as follows:

  • C-terminal engagement (Site 1):

    • The C-terminal nonapeptide (C9, YFPGQFAFS) of chemerin inserts into the transmembrane (TM) binding pocket

    • This insertion is both necessary and sufficient for GPR1 signaling

    • C9 alone can activate GPR1, demonstrating the functional importance of this interaction

  • N-terminal core interactions (Site 2):

    • The bulky N-terminal core of full-length chemerin interacts with a β-strand located at the N-terminus of GPR1

    • This interaction involves multiple β-strands of full-length chemerin, forming a β-sheet

    • This β-sheet serves as a "lid" for the TM binding pocket

  • Energetic considerations:

    • Molecular dynamics simulations with free energy landscape analysis indicate that removing the β-sheet "lid" is energetically expensive

    • This suggests a stabilizing role for the N-terminal interaction, potentially leading to prolonged receptor activation

Implications:

  • The dual binding mode may allow for more selective drug design targeting either site

  • C9 peptide derivatives could serve as lead compounds for developing more potent and selective GPR1 modulators

  • Understanding this binding model helps explain why C9 is an activating peptide at GPR1 and how full-length chemerin enhances interaction with GPR1

What methodological approaches can be used to assess the functional consequences of GPR1 genetic variants?

Genetic variations in GPR1 may lead to differential responses to therapeutics . To assess these functional consequences, researchers can employ a multi-faceted approach:

  • Identification of variants:

    • Next-generation sequencing to identify GPR1 variants in population cohorts

    • Bioinformatic analysis to predict functional impacts using tools like PolyPhen-2, SIFT

  • In vitro functional characterization:

    • Site-directed mutagenesis to introduce specific variants into GPR1 expression constructs

    • Stable cell lines expressing variant GPR1 receptors

    • Comparative signaling assays measuring:

      • Ligand binding affinity using radioligand binding

      • G protein coupling efficacy

      • β-arrestin recruitment kinetics

      • Receptor internalization rates

      • Downstream signaling activation (ERK, Akt pathways)

  • Structural analysis:

    • Molecular modeling of variants based on existing cryo-EM structures

    • Molecular dynamics simulations to assess conformational changes induced by mutations

    • Analysis of how variants might disrupt the "two-site" binding model of chemerin

  • Systems biology approaches:

    • Transcriptomic analysis of cells expressing variant GPR1 receptors

    • Phosphoproteomic analysis to identify altered signaling pathways

    • Network analysis to identify compensatory mechanisms

This comprehensive approach allows researchers to understand how specific GPR1 variants might alter receptor function and potentially contribute to disease states or differential drug responses.

How can molecular dynamics simulations enhance our understanding of GPR1 activation mechanisms?

Molecular dynamics (MD) simulations have become invaluable tools for studying GPCR activation, including GPR1. Recent research has demonstrated several key applications :

  • Binding pocket dynamics:

    • MD simulations can reveal conformational changes in the binding pocket upon ligand binding

    • Identification of key residues that stabilize ligand-receptor interactions

    • Analysis of water molecule networks that may mediate interactions

  • Free energy calculations:

    • Parallel bias metadynamics can estimate the unbinding free energy landscape of ligands

    • For example, research has compared the energetics of C9 peptide versus full-length chemerin binding to GPR1

    • These calculations revealed that removing the β-sheet "lid" formed by full-length chemerin is energetically expensive

  • Conformational sampling:

    • Long timescale simulations (multiple 1-μs trajectories) can sample receptor conformations not captured in static structures

    • Time-lagged independent component analysis (TICA) can be used to reduce the dimensionality of the data for visualization

    • This approach allows mapping of high-dimensional free energy landscapes onto meaningful reaction coordinates

  • Simulation protocol example from recent GPR1 research :

    • Protonation state assignment using H++ web server at pH 7.4

    • CHARMM36m force field employment

    • Energy minimization and membrane relaxation

    • Multiple independent 1-μs production MD simulations

    • Collection of 50,000 conformations from trajectory ensembles

    • Hydrogen bond identification based on distance and angle cutoffs

For GPR1 specifically, MD simulations have provided insights into why the C9 peptide can activate the receptor and how full-length chemerin enhances interaction through its N-terminal domain, supporting the "two-site" binding model .

What are the best approaches for studying cross-talk between GPR1 and other signaling pathways?

Investigating signaling cross-talk involving GPR1 requires sophisticated experimental approaches:

  • Proteomics-based interactome mapping:

    • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity to GPR1

    • Co-immunoprecipitation followed by mass spectrometry

    • BRET/FRET-based interaction screening with candidate pathway components

  • Phosphoproteomics:

    • Temporal phosphoproteomic profiling following GPR1 activation

    • Comparison of phosphorylation patterns with and without inhibitors of specific pathways

    • Bioinformatic analysis to identify kinase activation patterns

  • Transcriptional profiling:

    • RNA-seq following GPR1 activation in the presence/absence of other pathway modulators

    • ChIP-seq to identify transcription factors activated downstream of GPR1

    • Single-cell RNA-seq to capture cell-to-cell variability in responses

  • Advanced imaging techniques:

    • Multi-color live-cell imaging of pathway-specific biosensors

    • Super-resolution microscopy to visualize receptor clustering and co-localization

    • FRET sensors for monitoring second messenger production spatiotemporally

  • Mathematical modeling:

    • Ordinary differential equation (ODE) models of GPR1 signaling network

    • Parameter estimation using experimental data

    • Sensitivity analysis to identify key pathway interactions

This multi-faceted approach enables researchers to dissect the complex interactions between GPR1 and other signaling pathways, which is crucial for understanding its physiological roles and potential as a therapeutic target.

What are common challenges in expressing functional recombinant GPR1, and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant GPR1:

ChallengeCauseSolution
Low expression levelsToxicity to host cells; inefficient translationUse inducible expression systems; optimize codon usage for host; try different cell lines
Protein aggregationImproper folding of transmembrane domainsAdd stabilizing agents (glycerol, specific lipids); optimize detergent selection; reduce expression temperature
Poor membrane localizationInefficient trafficking; retention in ERInclude signal sequences; use cell lines with robust trafficking machinery; add chaperones
Loss of functionDenaturation during purificationOptimize detergent concentration; add cholesterol; use liposome reconstitution
Thermal instabilityInherent GPCR flexibilityIntroduce stabilizing mutations; optimize buffer conditions

When expressing GPR1, it's advisable to avoid heating the protein before electrophoresis as this may cause aggregation . Additionally, aliquoting the protein to avoid repeated freezing and thawing can help maintain functionality.

The wheat germ expression system with proprietary liposome technology has been successfully used to produce functional human GPR1 , suggesting this could be a good starting point for researchers facing expression challenges.

How can researchers design robust controls for GPR1 signaling experiments?

Designing appropriate controls is crucial for GPR1 signaling experiments:

  • Negative controls:

    • Mock-transfected cells lacking GPR1 expression

    • Cells expressing non-functional GPR1 mutants (specific mutations in the binding pocket)

    • Treatment with vehicle solutions matching ligand preparations

  • Positive controls:

    • Cells expressing known well-characterized GPCRs (e.g., β2-adrenergic receptor)

    • Treatment with established GPR1 ligands (chemerin) at saturating concentrations

    • Internal assay standards (forskolin for cAMP assays)

  • Specificity controls:

    • Dose-response experiments to establish concentration-dependence

    • Competition experiments with unlabeled ligands

    • Use of pathway-specific inhibitors to confirm signaling mechanisms

  • Technical controls:

    • Inter-assay calibrators to normalize between experimental runs

    • Temperature and time controls to account for receptor degradation

    • Expression level monitoring (via Western blot or flow cytometry) to normalize for receptor density

  • Control for off-target effects:

    • Scrambled peptide controls for peptide ligands

    • Testing ligands on related GPCRs to assess selectivity

    • Parallel screening for activation of unrelated pathways

Implementing these controls will help ensure that observed effects are specifically due to GPR1 activation and not experimental artifacts or off-target activities.

What are the most promising therapeutic applications of GPR1 research?

Based on current understanding of GPR1 biology, several therapeutic areas show particular promise:

  • Metabolic disorders:

    • GPR1 plays a role in energy homeostasis through its interaction with chemerin

    • Potential target for obesity and type 2 diabetes, similar to other GPCR targets like GLP-1R

    • Modulation might influence glucose metabolism and insulin sensitivity

  • Inflammatory conditions:

    • GPR1's role in chemerin signaling suggests involvement in inflammatory processes

    • Potential applications in autoimmune diseases and chronic inflammation

    • Selective antagonists might reduce inflammatory signaling

  • Cancer:

    • GPR1 signaling may influence tumor microenvironment and cancer progression

    • Potential for targeted therapies based on GPR1 expression in certain cancers

    • Opportunities for developing antibody-drug conjugates targeting GPR1

  • Neurological disorders:

    • GPR1 acts as a receptor for TAFA1, mediating effects on neuronal stem-cell proliferation and differentiation

    • Potential applications in neurodegenerative diseases and neural development disorders

    • Opportunities for modulating neural stem cell fate

  • Personalized medicine approaches:

    • Genetic variations in GPR1 may affect drug responses

    • Genotyping could help predict individual responses to GPR1-targeting therapies

    • Development of variant-specific therapeutics

The recent elucidation of the GPR1 structure bound to chemerin provides crucial insights for structure-based drug design efforts targeting this receptor.

What technological advances might accelerate GPR1 research in the coming years?

Several emerging technologies are likely to significantly impact GPR1 research:

  • AI-driven structure prediction and drug design:

    • AlphaFold and RoseTTAFold can predict protein structures with high accuracy

    • Machine learning approaches for virtual screening of potential GPR1 ligands

    • AI-guided optimization of lead compounds targeting specific GPR1 conformations

  • Advanced cryo-EM techniques:

    • Improved resolution for membrane protein structures

    • Time-resolved cryo-EM to capture intermediate states during activation

    • Smaller sample requirements enabling studies of challenging variants

  • Single-molecule imaging and analysis:

    • Super-resolution microscopy of individual GPR1 molecules in living cells

    • Single-molecule FRET to monitor conformational changes upon activation

    • Tracking of individual receptor-ligand interactions in real-time

  • Genome editing technologies:

    • CRISPR-Cas9 for precise introduction of GPR1 variants

    • Base editing for specific nucleotide modifications

    • Prime editing for introducing complex modifications without double-strand breaks

  • Organoid and microphysiological systems:

    • Patient-derived organoids for testing GPR1-targeting compounds

    • Organ-on-chip models incorporating GPR1-expressing cells

    • Systems allowing for assessment of tissue-specific GPR1 functions

  • Advanced computational methods:

    • Enhanced sampling techniques for MD simulations

    • Markov state modeling of GPR1 conformational dynamics

    • Quantum mechanics/molecular mechanics (QM/MM) for detailed binding studies

These technological advances promise to deepen our understanding of GPR1 biology and accelerate the development of therapeutics targeting this receptor system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.