Recombinant Human G-protein coupled receptor 26 (GPR26)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant GPR26

Recombinant human GPR26 is a 337-amino-acid protein with seven transmembrane domains (TMDs) and a C-terminal tail critical for G-protein coupling . Key features include:

PropertyDetail
UniProt IDQ8NDV2
Constitutive ActivitySignals via Gαs, elevating cAMP without exogenous ligands
Tissue ExpressionHigh in hypothalamus, cortex, and amygdala; lower in peripheral tissues
Structural MotifsConserved DRY motif (Asp-Arg-Tyr) in TMD3; NPxxY motif in TMD7

Production typically uses HEK293 or CHO cells with tags (e.g., FLAG, HA) for purification . Solubilization requires detergents like DDM, highlighting its hydrophobic nature .

Metabolic Regulation

  • Obesity Models: GPR26 knockout mice exhibit hyperphagia, reduced energy expenditure, and early-onset obesity due to AMPK overactivation in the hypothalamus .

  • Glucose Homeostasis: GPR26 downregulation in monocytes correlates with hyperglycemia-induced oxidative stress and impaired autophagy .

Neuropsychiatric Disorders

  • Anxiety/Depression: GPR26-deficient mice show elevated anxiety-like behaviors and reduced phosphorylated CREB in the amygdala .

  • Neurodegeneration: GPR26 expression inversely correlates with neurofibrillary tangles in Alzheimer’s disease .

Cancer

  • Glioblastoma: GPR26 suppresses tumor growth, with loss-of-function mutations observed in primary glioblastomas .

Signaling Mechanisms

GPR26 signals primarily through:

  • Gαs/cAMP Pathway: Constitutive activation increases cAMP, modulating appetite-regulatory neurons in the hypothalamus .

  • AMPK Interaction: Phosphorylation of AMPK at Ser172 drives hyperphagia in knockout models .

  • Cross-talk with CB1: Co-expression with cannabinoid receptor CB1 enhances rimonabant’s weight-loss effects .

Obesity

  • GPR26 activation could mimic rimonabant’s appetite suppression without psychiatric side effects .

  • Lead Compounds: None identified yet, but high-throughput screening campaigns are ongoing .

Neuroprotection

  • GPR26 agonists may counteract Aβ-induced toxicity in Alzheimer’s disease by modulating AMPK/CREB pathways .

Cancer

  • Restoring GPR26 expression in glioblastoma models reduces tumor proliferation .

Research Challenges

  • Ligand Identification: No endogenous or synthetic agonists/antagonists are validated, limiting mechanistic studies .

  • Structural Data: No full-length crystal structure exists; homology modeling relies on class A GPCR templates .

  • In Vivo Specificity: Overlap with CB1 signaling complicates obesity studies .

Key Research Findings

Study FocusModelKey OutcomeImplication
Diet-Induced ObesityGPR26 KO Mice21% weight gain vs. wild-type Validates anti-obesity target potential
HyperglycemiaHuman PBMCsGPR26 downregulation under chronic HG Links GPR26 to diabetic complications
GlioblastomaPatient Tumor SamplesReduced GPR26 in high-grade tumors Supports tumor-suppressive role

Future Directions

  1. Ligand Discovery: Screen chemical libraries using recombinant GPR26 to identify tool compounds .

  2. Structural Studies: Cryo-EM to resolve activation mechanisms and allosteric sites .

  3. Clinical Translation: Evaluate GPR26 agonists in obesity and neurodegenerative disease models .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please contact your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR26; G-protein coupled receptor 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNSWDAGLAGLLVGTMGVSLLSNALVLLCLLHSADIRRQAPALFTLNLTCGNLLCTVVNM PLTLAGVVAQRQPAGDRLCRLAAFLDTFLAANSMLSMAALSIDRWVAVVFPLSYRAKMRL RDAALMVAYTWLHALTFPAAALALSWLGFHQLYASCTLCSRRPDERLRFAVFTGAFHALS FLLSFVVLCCTYLKVLKVARFHCKRIDVITMQTLVLLVDLHPSVRERCLEEQKRRRQRAT KKISTFIGTFLVCFAPYVITRLVELFSTVPIGSHWGVLSKCLAYSKAASDPFVYSLLRHQ YRKSCKEILNRLLHRRSIHSSGLTGDSHSQNILPVSE
Uniprot No.

Target Background

Function
GPR26 is an orphan receptor exhibiting significant constitutive activity. Its effect is mediated by G(s)-alpha protein, which stimulates adenylate cyclase, resulting in an increase in intracellular cAMP levels.
Gene References Into Functions
  1. GPR26 may play a common role in the formation or degradation of intranuclear inclusions in several neurodegenerative diseases. PMID: 26303144
  2. Research has identified GPR26 as a genetic indicator of primary glioblastoma, suggesting that it could act as a suppressor of primary glioblastoma development. PMID: 18037267
  3. Epigenetic silencing is a prevalent mechanism in malignant gliomas that simultaneously inactivates MGMT and GPR26. PMID: 19787267
Database Links

HGNC: 4481

OMIM: 604847

KEGG: hsa:2849

STRING: 9606.ENSP00000284674

UniGene: Hs.12751

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the CNS, the highest expression is seen in the amygdala, hippocampus and thalamus. Weak expression is detected in testis. Down-regulated in glioblastoma.

Q&A

What is GPR26 and how does it fit within the GPCR superfamily?

GPR26 is a human G-protein coupled receptor that belongs to the Class A (rhodopsin-like) subfamily of GPCRs. GPCRs represent the largest protein family encoded by the human genome, with 826 members divided into classes A (rhodopsin), B (secretin and adhesion), C (glutamate), and F (Frizzled) based on amino acid sequences . GPR26 is considered an orphan receptor, meaning its endogenous ligand(s) remain unidentified. Within the context of the larger GPCR family, GPR26 is part of approximately 350 non-olfactory members regarded as druggable targets, though it has not yet been extensively characterized compared to other GPCRs like adrenergic or adenosine receptors .

What are the primary structural characteristics of GPR26?

Like other Class A GPCRs, GPR26 possesses the canonical seven-transmembrane (7TM) domain structure. The receptor consists of:

  • An extracellular N-terminus

  • Seven transmembrane α-helices (TM1-TM7)

  • Three extracellular loops (ECL1-3)

  • Three intracellular loops (ICL1-3)

  • An intracellular C-terminus potentially containing an eighth helix (Helix 8)

Based on structural patterns observed in other Class A GPCRs, GPR26 likely contains conserved structural motifs such as the PIF, CWxP, and NPxxY motifs that are critical for activation mechanisms . The disulfide bond between ECL1 and ECL2 (typically between residues in positions 3x25 and 45x50 using GPCRdb numbering) is likely present in GPR26 as this feature is highly conserved and critical for receptor stability .

What signaling pathways are associated with GPR26?

GPR26 is primarily coupled to the Gs protein signaling pathway, leading to activation of adenylyl cyclase and subsequent increase in intracellular cyclic AMP (cAMP) levels. This coupling is consistent with the general mechanism by which many Class A GPCRs transduce extracellular signals into intracellular responses . Upon activation, GPR26 likely undergoes conformational changes similar to those documented in other GPCRs, particularly the outward movement of TM6 which is a hallmark of GPCR activation . The downstream effects of GPR26 activation and its potential cross-talk with other signaling pathways remain areas requiring further investigation.

What experimental systems are used to study recombinant GPR26?

Several expression systems can be employed for studying recombinant GPR26:

Expression SystemAdvantagesLimitationsBest Applications
HEK293T cellsHuman-derived, suitable post-translational modifications, established for GPCR functional studiesLower yield than insect cellsFunctional assays, signaling studies
Sf9 insect cellsHigh expression yields, suitable for large-scale productionDifferent glycosylation patternsProtein production for structural studies
E. coliCost-effective, high yieldLimited post-translational modifications, often forms inclusion bodiesExpression of soluble domains
Cell-free systemsRapid screening, avoids cell toxicity issuesLower yield, higher costInitial construct optimization

The baculovirus-insect cell system has been successfully used for expression screening of all 826 human GPCRs, suggesting it may be suitable for GPR26 as well . For functional studies, mammalian cell lines with engineered transcriptional reporters (such as CRE-based reporters for cAMP detection) provide valuable platforms to assess GPR26 activity .

How should I design optimal constructs for recombinant GPR26 expression?

Construct design is critical for successful GPR26 expression. Based on established approaches for other GPCRs, consider the following strategy:

  • Truncations: Use computational prediction tools to identify the core 7TM domain of GPR26. Consider truncating flexible N- and C-termini while preserving important structural elements . For GPR26, ensure that any N-terminal cysteine residues that might form disulfide bonds with ECL3 are retained in the construct.

  • Fusion partners: Incorporate fusion partners to enhance expression and stability. Cytochrome b₅₆₂ RIL (BRIL) has proven effective for many GPCRs in both N-terminal (Nt_BRIL) and ICL3 (ICL3_BRIL) positions . For GPR26, testing both configurations is advisable as different GPCRs show different preferences.

  • Tags: Include affinity tags (His₆, FLAG, etc.) for purification and detection. An N-terminal tag can improve detection sensitivity in expression screening .

  • Codon optimization: Optimize codons for your expression system, particularly for insect cells or E. coli.

  • Signal sequences: Consider incorporating signal sequences (e.g., hemagglutinin) to enhance membrane targeting.

Based on large-scale GPCR expression studies, Nt_BRIL constructs generally yield higher expression levels than ICL3_BRIL constructs , suggesting this might be a good starting point for GPR26.

What strategies can improve functional expression of GPR26?

Optimizing functional expression of GPR26 requires a multi-faceted approach:

  • Expression system selection: HEK293T cells are preferable for functional studies, while Sf9 cells may yield higher protein levels for structural studies .

  • Stabilizing mutations: Consider introducing stabilizing mutations based on conserved residues in Class A GPCRs. Mutations at positions equivalent to the highly conserved motifs (PIF, CWxP, NPxxY) should be avoided as these are typically intolerant to mutation .

  • Culture conditions: Optimize culture temperature (30-32°C often improves folding), induction time, and media composition.

  • Cholesterol supplementation: Consider cholesterol supplementation as many GPCRs have cholesterol-binding sites that stabilize their structure .

  • Pharmacological chaperones: If a ligand is known or suspected, its addition during expression can improve folding and trafficking.

  • Bxb1-landing pad system: For mammalian expression, consider the Bxb1-landing pad system which allows stable, site-specific integration at transcriptionally-silent loci like H11, preventing position effects on expression .

  • Knockout endogenous receptors: In functional studies, knockout endogenous receptors that might interfere with signaling assays, as was done for β₂AR in HEK293T cells .

What are the most effective methods for detecting GPR26 activation?

Several complementary approaches can be used to detect and quantify GPR26 activation:

  • Barcoded transcriptional reporters: Utilize cAMP response element (CRE) reporters that produce barcoded mRNA in response to GPR26-mediated cAMP production. This approach allows high-throughput screening with RNA-seq quantification .

  • BRET/FRET-based assays: Employ biosensors based on bioluminescence or fluorescence resonance energy transfer to monitor cAMP production or G protein activation in real-time.

  • GloSensor™ assay: This luminescence-based assay provides a sensitive readout of cAMP levels and is suitable for high-throughput screening.

  • Immunoblotting: Measure downstream signaling events such as CREB phosphorylation as indicators of the cAMP pathway activation.

  • Electrophysiology: Monitor ion channel activity modulated by GPR26 signaling in appropriate cell systems.

For high-throughput applications, the barcoded transcriptional reporter system is particularly valuable as it allows multiplexed analysis of GPR26 variants or screening of compound libraries .

How can I perform structural characterization of recombinant GPR26?

Structural characterization of GPR26 presents significant challenges but can be approached through:

  • Cryo-EM preparation: For GPR26 preparation for cryo-EM:

    • Express with fusion partners (BRIL or similar) to increase molecular weight and provide structural rigidity

    • Purify in lipid nanodiscs or detergent micelles with careful optimization

    • Consider antibody fragments or nanobodies to stabilize specific conformations

  • Homology modeling: Develop computational models based on closely related GPCRs with known structures. The alignment should focus on the 7TM core which is more conserved than loop regions .

  • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): This technique can provide insights into protein dynamics and conformational changes without requiring crystallization.

  • Molecular dynamics simulations: Simulate GPR26 behavior in membrane environments, particularly focusing on potential water-mediated hydrogen bond networks which are known to be critical for GPCR function .

  • Deep mutational scanning: Consider applying approaches similar to those used for β₂AR, where comprehensive mutagenesis revealed structural features that were not apparent in static structures .

What approaches can identify potential ligands for orphan GPR26?

As an orphan receptor, identifying ligands for GPR26 is a primary research challenge:

  • Computational screening: Use machine learning approaches trained on known GPCR-ligand pairs to predict potential GPR26 ligands. Focus on compounds that target related receptors within Class A.

  • Tissue extract fractionation: Prepare extracts from tissues with high GPR26 expression, fractionate by chromatography, and test fractions for GPR26 activation.

  • Deorphanization platforms: Develop high-throughput screening platforms using the CRE reporter system to screen compound libraries, including:

    • Natural product libraries

    • Known neurotransmitters and neuropeptides

    • Lipid libraries

    • Fragment-based screens

  • Reverse pharmacology: Identify tissues or physiological conditions where GPR26 is highly expressed or regulated, and investigate molecular components associated with these conditions.

  • Cross-species comparative analysis: Examine ligands for GPR26 orthologs in other species that may have been characterized.

  • Co-expression analysis: Identify enzymes co-expressed with GPR26 that might produce its endogenous ligands.

How can mutagenesis approaches advance our understanding of GPR26?

Strategic application of mutagenesis can provide valuable insights into GPR26 structure and function:

  • Deep mutational scanning (DMS): Similar to studies on β₂AR , comprehensive single amino acid substitution libraries can identify:

    • Residues critical for GPR26 folding and expression

    • Regions involved in G protein coupling

    • Potential ligand binding sites

    • Structural motifs unique to GPR26

  • Targeted mutagenesis of conserved motifs: Focus on equivalent residues to known functional motifs in Class A GPCRs:

    • PIF motif (activation microswitch)

    • CWxP motif (conformational toggle)

    • NPxxY motif (interaction with G proteins)

    • DRY motif (G protein coupling)

  • Water-mediated hydrogen bond networks: Target residues likely involved in water-mediated networks, such as those equivalent to N51, D79, and Y326 in β₂AR .

  • Identification of constitutively active mutants: Mutations that increase basal activity can reveal activation mechanisms and might help identify residues involved in ligand binding.

  • Analysis approach: When analyzing mutagenesis data, leverage unsupervised learning approaches to cluster mutations based on their functional effects, which can reveal structural and functional relationships .

What are the implications of the extracellular loop regions in GPR26 function?

Extracellular loops (ECLs) play critical roles in GPCR function and may be particularly important for GPR26:

  • ECL structural features: ECLs contain key structural elements, including the conserved disulfide bond between ECL2 and TM3 . In GPR26, the equivalent of residue W99 in β₂AR (located in ECL1) may be critical for stabilizing this disulfide bond through specific interactions .

  • Ligand access and selectivity: ECLs form the entrance to the orthosteric binding pocket and contribute to ligand selectivity. For GPR26, the ECL structure may determine which molecules can access its binding site.

  • Allosteric binding sites: ECLs often form allosteric binding sites in GPCRs. Targeting these sites in GPR26 may provide alternative ways to modulate its activity when orthosteric ligands are unknown.

  • Structural latch: Recent research on β₂AR identified a previously uncharacterized structural latch spanning ECL1 and ECL2 that is highly conserved across Class A GPCRs and remains conformationally rigid in both inactive and active states . This feature may be present in GPR26 and critical for its function.

  • Experimental approach: To characterize ECL functions in GPR26:

    • Generate ECL chimeras with related receptors

    • Perform alanine scanning across ECL regions

    • Use cross-linking studies to identify ECL interactions

    • Apply molecular dynamics simulations to predict ECL dynamics

How can I address poor expression or misfolding of recombinant GPR26?

Poor expression or misfolding of GPR26 can be addressed through systematic troubleshooting:

What approaches can resolve contradictory data in GPR26 signaling studies?

Resolving contradictory signaling data requires systematic investigation:

  • Assay normalization and standardization:

    • Use multiple signaling readouts (cAMP, pERK1/2, arrestin recruitment)

    • Include appropriate positive controls (forskolin for cAMP pathways)

    • Normalize data to receptor expression levels

    • Standardize experimental conditions (cell density, passage number)

  • Receptor heterogeneity analysis:

    • Investigate potential post-translational modifications

    • Consider receptor oligomerization

    • Examine potential interactions with accessory proteins

  • Statistical approach to contradictions:

    • Perform meta-analysis of results across different experimental systems

    • Use Bayesian statistical methods to integrate contradictory data

    • Consider concentration-response relationships rather than single-point measurements

  • Cell context considerations:

    • Test signaling in multiple cell backgrounds

    • Examine endogenous expression of signaling components

    • Consider the impact of cell-specific regulatory mechanisms

  • Experimental design refinement:

    • Use CRISPR/Cas9 to knockout potential interfering pathways

    • Employ bicistronic expression systems to ensure consistent expression ratios

    • Consider inducible expression systems to control expression timing and level

What bioinformatic tools are most valuable for GPR26 research?

Several bioinformatic tools can enhance GPR26 research:

  • Sequence analysis tools:

    • GPCRdb (https://gpcrdb.org) - for GPCR-specific alignments and annotations

    • ConSurf - for evolutionary conservation analysis

    • PSIPRED - for secondary structure prediction

  • Structural prediction tools:

    • AlphaFold2 - for accurate structure prediction

    • MODELLER - for homology modeling based on related GPCRs

    • MDPocket - for binding pocket prediction

    • PyMOL and UCSF Chimera - for structural visualization and analysis

  • Molecular dynamics resources:

    • GROMACS or AMBER - for MD simulations

    • CHARMM-GUI - for membrane protein-lipid system preparation

    • VMD - for trajectory visualization and analysis

  • Functional prediction tools:

    • GPCR-CoINPocket - for consensus orthosteric binding site prediction

    • PREDGPCR - for GPCR-specific functional site prediction

    • COACH-D - for ligand binding site prediction

  • Data integration platforms:

    • STRING - for protein-protein interaction networks

    • ENRICHR - for pathway and GO term enrichment analysis

    • GeneMANIA - for gene function prediction based on network data

These tools can help predict GPR26 structure, identify potential binding sites, understand evolutionary relationships, and guide experimental design.

How can I distinguish between direct and indirect effects in GPR26 signaling?

Distinguishing direct from indirect signaling effects requires careful experimental design:

  • G protein coupling profiling:

    • Use BRET assays with multiple G protein biosensors to identify direct coupling partners

    • Employ G protein-selective inhibitors (Pertussis toxin for Gi/o, YM-254890 for Gq/11)

    • Utilize CRISPR knockout cells lacking specific G protein subunits

  • Temporal resolution analysis:

    • Perform high-resolution time-course studies to separate immediate from delayed responses

    • Use rapid application systems for acute stimulation

    • Apply mathematical modeling to deconvolute signaling kinetics

  • Pathway deconvolution approaches:

    • Systematically inhibit downstream pathways to identify dependencies

    • Use phosphoproteomic analysis to map signaling networks

    • Apply CRISPR screens to identify essential components

  • Reconstitution in minimal systems:

    • Reconstitute GPR26 with purified G proteins in artificial membrane systems

    • Use cell-free expression systems with defined components

    • Employ nanobody-based biosensors to detect direct conformational changes

  • Biased signaling analysis:

    • Calculate bias factors between different pathways

    • Compare signaling fingerprints across different conditions

    • Use operational models to distinguish efficacy from potency effects

What novel technologies might advance GPR26 characterization?

Emerging technologies offer new opportunities for GPR26 research:

  • Single-cell analysis:

    • Single-cell RNA-seq to identify co-expressed genes in GPR26-positive cells

    • CyTOF for simultaneous detection of multiple signaling nodes

    • Single-cell western blotting for protein analysis

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) for localization studies

    • Single-molecule tracking to monitor receptor dynamics

    • FRET-FLIM for quantitative protein interaction studies

  • Structural biology innovations:

    • Microcrystal electron diffraction (MicroED) for structure determination from small crystals

    • Cryo-electron tomography for in situ structural studies

    • Integrative structural biology combining multiple experimental approaches

  • Genetic engineering approaches:

    • Base editing for precise modification of GPR26 in native contexts

    • CRISPR activation/repression systems to modulate GPR26 expression

    • Optogenetic and chemogenetic tools for temporal control of GPR26 signaling

  • Computational advances:

    • Deep learning for structure prediction and virtual screening

    • Molecular dynamics simulations with quantum mechanics/molecular mechanics (QM/MM)

    • Network pharmacology approaches to predict drug effects

These technologies will enable more precise characterization of GPR26 structure, function, and physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.