Recombinant Human G-protein coupled receptor 39 (GPR39)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology

GPR39 exhibits constitutive activity and signals through Gαq/11, Gα12/13, and Gαs pathways . Its zinc-dependent activation regulates:

Key Physiological Processes

  • Glucose Homeostasis: Modulates insulin secretion and pancreatic β-cell function .

  • Wound Healing: Enhances keratinocyte migration via ERK/MAPK and PI3K/AKT pathways .

  • Neurovascular Regulation: Maintains glycinergic inhibition in spinal SOM⁺ interneurons, reducing mechanical pain .

  • Gastrointestinal Motility: Regulates gastric somatostatin secretion and intestinal contractility .

Disease Associations and Therapeutic Potential

GPR39 dysregulation is linked to multiple pathologies:

Disease/ConditionMechanismResearch Findings
Type 2 DiabetesReduced GPR39 expression impairs insulin secretion Gpr39⁻/⁻ mice exhibit hyperglycemia and β-cell dysfunction .
Chronic PainLoss of GlyR-GPR39 interaction enhances spinal nociceptive signaling Pharmacological GPR39 activation alleviates inflammatory pain in rodent models .
Cardiovascular DiseaseGWAS-identified SNPs (e.g., rs13420028) correlate with hypertension and CAD GPR39 regulates endothelial cell survival via PEDF secretion .
DepressionAltered Zn²⁺-GPR39 signaling disrupts serotonin receptor crosstalk GPR39 agonists reverse depressive-like behavior in preclinical studies .

Research Applications

Recombinant GPR39 is critical for:

  • Ligand Screening: Identifies synthetic agonists (e.g., GPR39-C3, GSB-118) that mimic Zn²⁺-mediated signaling .

  • Pathway Analysis: Measures Ca²⁺ flux (via Gαq) and cAMP production (via Gαs) .

  • Structural Studies: Resolves receptor-ligand interactions using cryo-EM or homology modeling .

Key Research Studies

Study FocusModelKey FindingSource
Glycinergic InhibitionSOM-Cre MiceGPR39 knockdown reduces GlyR-mIPSC amplitudes, exacerbating mechanical pain .
Pancreatic β-Cell FunctionGpr39⁻/⁻ MiceGpr39 deletion impairs glucose-stimulated insulin secretion .
Synthetic Agonist DevelopmentHEK293T CellsGPR39-C3 activates Gαs and Gαq pathways without β-arrestin recruitment .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR39; G-protein coupled receptor 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-453
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MASPSLPGSDCSQIIDHSHVPEFEVATWIKITLILVYLIIFVMGLLGNSATIRVTQVLQK KGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTSSYTLSCKLHTFLFEACSY ATLLHVLTLSFERYIAICHPFRYKAVSGPCQVKLLIGFVWVTSALVALPLLFAMGTEYPL VNVPSHRGLTCNRSSTRHHEQPETSNMSICTNLSSRWTVFQSSIFGAFVVYLVVLLSVAF MCWNMMQVLMKSQKGSLAGGTRPPQLRKSESEESRTARRQTIIFLRLIVVTLAVCWMPNQ IRRIMAAAKPKHDWTRSYFRAYMILLPFSETFFYLSSVINPLLYTVSSQQFRRVFVQVLC CRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQ SKSQSLSLESLEPNSGAKPANSAAENGFQEHEV
Uniprot No.

Target Background

Function
Zn(2+) acts as an agonist. This receptor mediates its action through association with G proteins, which activate a phosphatidylinositol-calcium second messenger system. Its effect is primarily mediated through G(q)-alpha and G(12)/G(13) proteins. It plays a role in the regulation of body weight, gastrointestinal mobility, hormone secretion, and cell death.
Gene References Into Functions
  1. Data suggests that Zn(2+), acting via ZnR/GPR39, directly regulates Cl(-) absorption through upregulation of basolateral KCC1 in the colon. Additionally, colonocytic ZnR/GPR39 and KCC1 reduce water loss during diarrhea and may serve as effective drug targets. PMID: 28093242
  2. G protein-coupled receptor 39 (ZnR/GPR39) has been shown to regulate the activity of ion transport mechanisms crucial for the physiological function of epithelial and neuronal cells. PMID: 29389900
  3. Research indicates that expression of GPR39 undergoes Rho kinase-dependent desensitization following activation by zinc. PMID: 28619258
  4. This study demonstrated that zinc upregulates PKCzeta by activating GPR39 to enhance the abundance of ZO-1, thus improving epithelial integrity in S. typhimurium-infected Caco-2 cells. PMID: 28515165
  5. The obestatin/GPR39 system may be involved in the pathogenesis and/or clinical outcome of human gastric adenocarcinomas. GPR39 has the potential to serve as a prognostic marker in gastric cancer. PMID: 26716511
  6. Chronic administration of numerous antidepressants induces GPR39 up-regulation, suggesting that the Zn(2+)-sensing receptor could be a novel target for drug development in the field of depression. PMID: 25490458
  7. These findings provide a novel regulatory mechanism for GPR39-1b in NTRS1 signaling. PMID: 24512471
  8. ZnR/GPR39-dependent expression of tight junctional proteins contributes to the formation of a sealed intestinal epithelial barrier. PMID: 24967969
  9. Data suggests alterations (down-regulation) of the GPR39 receptor and involvement of the CREB-BDNF pathway, potentially triggered by GPR39, as a new pathomechanism of depression. PMID: 24333148
  10. Zn(2+) -dependent activation of ZnR/GPR39 also enhances the expression of the Ca(2+) -binding protein S100A4, which is linked to invasion of prostate cancer cells. PMID: 24264723
  11. GPR39 was present in thyroid autoimmune disease, non-toxic nodular goiter, and toxic nodular goiter at band p51(kDa). PMID: 23485550
  12. ZnR/GPR39 is sensitive to physiologically relevant changes in extracellular pH, which regulate ZnR-dependent signaling and ion transport activity. PMID: 22879599
  13. GPR39 activation increased the expression of the anti-apoptotic protein clusterin in butyrate-treated cells. GPR39 mediates Zn2+-dependent cell growth. PMID: 22545109
  14. GPR39 plays a significant tumorigenic role in the development and progression of esophageal squamous cell carcinoma. PMID: 21352519
  15. Extracellular Zn(2+), either applied or released following injury, activates ZnR/GPR39 to promote signaling leading to epithelial repair. PMID: 20522546
  16. Data shows that Phe-V:13 can serve as an aromatic lock for the proposed active conformation of the Trp-VI:13 rotameric switch, being involved in the global movement of TM-V and TM-VI in 7TM receptor activation. PMID: 19920139
  17. GPR39 is likely not the obestatin receptor. PMID: 16959833
  18. High concentrations of Zn(2+) could activate GPR39, demonstrating cell surface expression of a functional receptor that could elicit a Ca(2+) response. PMID: 17054911
  19. GPR39 functions as a Gq-coupled Zn2+-sensing receptor. PMID: 17885920
  20. GPR39 protects against cell death by increasing secretion of pigment epithelium-derived growth factor. PMID: 18180304
  21. It is proposed that Zn2+ acts as an agonist for GPR39, not in the classical manner by directly stabilizing an active conformation of the transmembrane domain, but instead by binding to His17 and His19 in the extracellular domain. PMID: 18588883

Show More

Hide All

Database Links

HGNC: 4496

OMIM: 602886

KEGG: hsa:2863

STRING: 9606.ENSP00000327417

UniGene: Hs.432395

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in many tissues, including the stomach, intestine and hypothalamus.

Q&A

What is the basic function of GPR39 and which signaling pathways does it activate?

GPR39 primarily functions as a zinc-sensing receptor that detects changes in extracellular Zn(2+) and mediates zinc signal transmission. It participates in regulating numerous physiological processes including glucose homeostasis, gastrointestinal mobility, hormone secretion, and cell death . At the molecular level, GPR39 activation leads to multiple downstream signaling events including:

  • Increased intracellular Ca(2+) concentration

  • Activation of ERK/MAPK and PI3K/AKT signaling pathways (particularly in keratinocytes)

  • Activation of the PKC/MAPK/CEBPB pathway for cytokine production, especially IL6

  • GNA13/RHOA/SRE-dependent signaling for cytoprotection

When forming heteroreceptor complexes with HTR1A, GPR39 shows additive increases in signaling along the serum response element (SRE) and NF-kappa-B pathways, while GALR1-GPR39 complexes demonstrate antagonistic interactions with GALR1 blocking SRE pathway activation .

How is GPR39 expression regulated in different tissues?

GPR39 expression is tightly regulated by several transcription factors and varies across tissues. Key regulatory mechanisms include:

  • Transcriptional control by hepatocyte nuclear factor (HNF)-1α and HNF-4α in a feed-forward multicomponent loop manner

  • Tissue-specific expression patterns, with predominant localization in endocrine and metabolic tissues

  • Selective expression in insulin-storing β-cells of pancreatic islets and duct cells of the exocrine pancreas

  • Developmental regulation during cell differentiation, as demonstrated in the AR42J pancreatic cell line, where GPR39 is downregulated during differentiation toward exocrine phenotypes but upregulated (along with Pdx-1) during differentiation toward endocrine phenotypes

These expression patterns suggest GPR39 plays critical roles in pancreatic development and function. Researchers should consider these tissue-specific expression patterns when designing experiments with recombinant GPR39.

What experimental models are available to study GPR39 function in vivo?

Several experimental models have been developed to study GPR39 function in vivo:

  • Gpr39 knockout mice: The most widely used model to assess GPR39's physiological roles

  • Cell line models expressing recombinant GPR39, including HEK293T cells for signaling studies

  • Point mutation models, such as the H17A/H19A double mutant, for studying structure-function relationships

  • Tissue-specific models focused on pancreatic islets, vascular endothelium, and pancreatic acinar cells

When working with Gpr39 knockout mice, researchers should note several phenotypic characteristics:

  • Normal insulin sensitivity but moderately impaired glucose tolerance in both oral and intravenous glucose tolerance tests

  • Decreased plasma insulin response to oral glucose

  • Normal islet architecture but reduced expression of Pdx-1 and Hnf-1α

  • Reduced response to bile acid-induced acute pancreatitis

  • Mitigation of vascular fibrosis and improved endothelium-dependent vasodilation in Ang II-induced hypertension models

How do the dual ligand specificities of GPR39 (zinc and bile acids) affect experimental design?

GPR39 demonstrates a unique dual-ligand specificity for both Zn(2+) and bile acids, which presents specific experimental considerations:

  • Ligand Interaction Analysis: Recent structural studies have identified that while H17 and H19 residues are crucial for Zn(2+) binding, these residues are not essential for bile acid-induced signaling. The H17A/H19A double mutant completely loses Zn(2+) responsiveness but maintains or even enhances bile acid responsiveness .

  • Experimental Buffer Composition: When studying GPR39, researchers must carefully control zinc concentrations in experimental buffers. The presence of 4 μM Zn(2+) can significantly potentiate bile acid responses, potentially confounding results if not properly controlled .

  • Receptor Activity Index (RAi) Measurement: For quantitative assessment of GPR39 activation, calculate the RAi as follows:

    • Divide efficacy value (Emax) by EC50 for each ligand

    • Normalize to maximum value among tested ligands

    • Take log10 of normalized values

    • For ambiguous EC50 values (>100 μM or >200 μM), set as 200 μM

    • For normalized RAi values <0.001, set as 0.001

    • Calculate RAi values in both presence and absence of 4 μM Zn(2+)

These methodological considerations are essential for accurate characterization of GPR39 pharmacology and function.

What are the optimal assays for measuring GPR39 activation in different experimental systems?

Depending on your experimental goals, several assays can be employed to measure GPR39 activation:

Calcium Mobilization Assays

  • Most widely used for studying GPR39 activation by both Zn(2+) and bile acids

  • Can be performed in recombinant systems (HEK293T cells) or primary cells (pancreatic acinar cells)

  • Results should be normalized to positive controls (e.g., acetylcholine for pancreatic acinar cells)

Amylase Release Assays (For Pancreatic Models)

  • Measure net amylase discharge from isolated pancreatic acinar cells

  • Compare responses to known secretagogues like caerulein

  • Critical for establishing GPR39's role in pancreatic exocrine function

Cell Death and Cellular Stress Assays

  • Propidium iodide (PI) uptake for measuring plasma membrane integrity

  • Lactate dehydrogenase (LDH) leakage assays

  • Morphological assessment of cell blebbing

  • Essential for studying GPR39's role in cell protection or bile acid-induced toxicity

In Vivo Functional Assays

  • Serum amylase and lipase measurements for pancreatitis models

  • Histological scoring of pancreatic inflammation, edema, and necrosis

  • Vascular function assessments including endothelium-dependent vasodilation

How does heteroreceptor complex formation affect GPR39 function and how can these interactions be studied?

GPR39 forms dynamic heteroreceptor complexes with other G-protein coupled receptors, creating signaling diversity. Key aspects of studying these interactions include:

  • Known Heteroreceptor Partners:

    • HTR1A (serotonin receptor 1A) - forms complexes that show additive increases in signaling along SRE and NF-kappa-B pathways

    • GALR1 (galanin receptor 1) - acts as an antagonist blocking SRE pathway when complexed with GPR39

  • Methodological Approaches:

    • Co-immunoprecipitation to detect physical interactions

    • Bioluminescence/fluorescence resonance energy transfer (BRET/FRET) to analyze receptor proximity

    • Proximity ligation assays for visualizing interactions in native tissues

    • Dual receptor expression systems with pathway-specific reporters (SRE, NF-kappa-B)

  • Functional Significance:

    • Cell type-specific effects: Heteroreceptor complex formation depends on cellular context

    • State-dependent dynamics: Complex formation can vary with physiological states

    • Pharmacological implications: Altered drug responses in the presence of receptor partners

Understanding these heteroreceptor interactions is crucial for interpreting GPR39 function in complex biological systems and may explain tissue-specific differences in GPR39 signaling.

What is the role of GPR39 in Ang II-induced hypertension and what therapeutic implications does this have?

Recent research has uncovered a significant role for GPR39 in Ang II-induced hypertension with considerable therapeutic potential:

Pathophysiological Role:

  • GPR39 expression is upregulated in the aorta of hypertensive patients and mice

  • Genetic ablation of GPR39 mitigates vascular fibrosis and improves endothelium-dependent vasodilation

  • GPR39 knockout inhibits endothelial inflammation, oxidative stress, and apoptosis in Ang II-induced hypertension models

  • GPR39 regulates NOD-like receptor protein 3 (Nlrp3) gene expression in Ang II-stimulated endothelial cells

Therapeutic Approaches:

  • Structure-based high throughput virtual screening (HTVS) has identified potential small molecule ligands of GPR39

  • The small molecule Z1780628919 has demonstrated antihypertensive functions both in vitro and in vivo

  • GPR39-targeting compounds may represent a novel class of antihypertensive agents with direct vascular protective effects

Mechanism of Action:
GPR39 knockout and pharmacological targeting potentially downregulate Nlrp3, thereby:

  • Mitigating vascular fibrosis

  • Reducing endothelial inflammation

  • Decreasing oxidative stress and apoptosis

  • Alleviating Ang II-induced hypertension

  • Improving vascular function

This evidence suggests that GPR39 represents a promising therapeutic target for treating hypertension, particularly in cases with prominent vascular dysfunction.

What are the methodological considerations for studying GPR39's role in bile acid signaling and acute pancreatitis?

When investigating GPR39's role in bile acid signaling and acute pancreatitis, researchers should consider several methodological approaches:

Experimental Models:

  • Gpr39 knockout mice for in vivo studies of bile acid-induced acute pancreatitis

  • Isolated pancreatic acinar cells from wild-type and Gpr39−/− mice

  • Comparative studies with Gpbar1−/− mice to distinguish GPR39-specific effects from those mediated by the known bile acid receptor GPBAR1

Key Experimental Readouts:

  • Calcium signaling in response to bile acids (particularly LCAS and TLCAS)

  • Cell injury markers: PI uptake, LDH leakage, cell blebbing

  • Amylase release from acinar cells

  • Serum amylase and lipase levels (in vivo)

  • Histological assessment of pancreatitis (edema, inflammation, necrosis)

How do specific mutations in the GPR39 receptor affect ligand binding and downstream signaling?

Understanding the structure-function relationship of GPR39 is critical for developing targeted therapeutics. Research has revealed several key structural features:

Zinc Binding Site:

  • Histidine residues H17 and H19 are critical for zinc sensing

  • H17A/H19A double mutants completely lose the ability to mediate calcium responses to Zn²⁺

  • These histidine residues appear to form part of a specific zinc-binding pocket

Bile Acid Interaction Site:

  • Unlike zinc binding, bile acid responses do not require H17 and H19 residues

  • H17A/H19A mutants maintain or even enhance responses to DCA and CDCA derivatives

  • This suggests separate binding sites for zinc and bile acids

Zinc-Bile Acid Cross-talk:

  • Wild-type GPR39 shows potentiation of bile acid responses in the presence of zinc

  • H17A/H19A mutants exhibit reduced zinc potentiation of cellular responses to bile acids

  • This indicates allosteric interaction between the zinc and bile acid binding sites

These findings suggest that distinct structural domains mediate GPR39's dual-ligand specificity, with potential for developing ligand-specific therapeutic modulators.

What methodological approaches are optimal for expression and purification of recombinant human GPR39?

Successful expression and purification of recombinant GPR39 requires careful consideration of several methodological factors:

Expression Systems:

  • HEK293T cells are commonly used for mammalian expression of functional GPR39

  • Insect cell systems (Sf9, High Five) may be useful for larger-scale protein production

  • Consider inclusion of N-terminal signal sequences and C-terminal purification tags

  • Codon optimization may improve expression levels

Purification Strategies:

  • Affinity chromatography using antibodies targeting the C-terminal region of GPR39

  • Consider detergent selection carefully as GPCRs require specific detergents for stability

  • Inclusion of zinc during purification may stabilize the receptor

Functional Validation:

  • Calcium mobilization assays to confirm responsiveness to zinc and bile acids

  • Western blotting using validated antibodies (e.g., ab229648 targeting the C-terminal region)

  • Immunohistochemistry on transfected cells to confirm membrane localization

Structural Characterization Options:

  • Circular dichroism to assess secondary structure

  • Limited proteolysis to identify stable domains

  • Thermal stability assays with varying ligand concentrations

These methodological considerations are essential for producing high-quality recombinant GPR39 suitable for downstream applications including structural studies, binding assays, and drug screening efforts.

What is the role of GPR39 in glucose homeostasis and how is it linked to diabetes?

GPR39 plays a significant role in glucose homeostasis with potential implications for diabetes:

Pancreatic Expression and Function:

  • Selectively expressed in insulin-storing β-cells of pancreatic islets

  • Regulated by HNF-1α and HNF-4α, which are MODY (Maturity-Onset Diabetes of the Young) genes

  • GPR39 follows the endocrine pancreatic differentiation pattern

Phenotype of GPR39-deficient Models:

  • Gpr39−/− mice display moderately impaired glucose tolerance in both oral and IV glucose tolerance tests

  • Decreased plasma insulin response to oral glucose

  • Normal insulin sensitivity

  • Normal islet architecture but reduced expression of Pdx-1 and Hnf-1α

  • Isolated islets from Gpr39−/− mice secrete less insulin in response to glucose

Regulatory Mechanisms:

  • GPR39 activation by zinc may contribute to zinc's known insulinotropic effects

  • Forms part of a regulatory network involving HNF-1α and HNF-4α in a feed-forward loop

  • May play a role in zinc sensing within the islet microenvironment

Therapeutic Implications:

  • GPR39 represents a potential novel target for diabetes treatment

  • Modulators of GPR39 activity might enhance glucose-stimulated insulin secretion

  • Understanding GPR39 dysfunction could provide insights into subtypes of diabetes

These findings position GPR39 as an important component of the glucose homeostasis machinery with clear relevance to diabetes pathophysiology and potential therapeutic interventions.

How does GPR39 contribute to protection against cell death and what are the key experimental readouts?

GPR39 has emerged as a significant mediator of cellular protection against various stress conditions:

Protective Mechanisms:

  • Inhibits cell death through multiple pathways

  • Protects against oxidative stress

  • Provides resistance to endoplasmic reticulum stress

  • Mitigates mitochondrial stress

Molecular Pathways:

  • Induces secretion of cytoprotective pigment epithelium-derived growth factor (PEDF)

  • Activates protective transcripts via GNA13/RHOA/SRE-dependent mechanisms

  • Forms heteroreceptor complexes with HTR1A, enhancing signaling through SRE and NF-kappa-B pathways

Experimental Readouts for Studying Cytoprotection:

  • Cell viability assays (MTT, resazurin reduction)

  • Apoptosis markers (Annexin V/PI staining, caspase activation)

  • Oxidative stress indicators (ROS levels, GSH/GSSG ratio)

  • ER stress markers (BiP/GRP78, CHOP expression)

  • Mitochondrial function (membrane potential, oxygen consumption)

  • PEDF secretion measurement by ELISA

  • Activation of downstream signaling (SRE reporter assays, RHOA activation)

Research Applications:

  • Evaluating cytoprotective potential of GPR39 agonists

  • Assessing GPR39's role in specific disease models with prominent cell death

  • Studying tissue-specific differences in GPR39-mediated protection

  • Developing targeted therapies for conditions with excessive cell death

Understanding GPR39's cytoprotective functions may lead to novel therapeutic approaches for diseases characterized by pathological cell death, including neurodegenerative disorders, ischemia-reperfusion injury, and inflammatory conditions.

What is the significance of GPR39 in vascular function and hypertension research?

Recent research has uncovered a previously unrecognized role for GPR39 in vascular biology and hypertension:

Expression and Regulation:

  • GPR39 expression is upregulated in the aorta of both hypertensive patients and mouse models

  • Appears to be induced by angiotensin II signaling in vascular tissues

Functional Impact on Vascular Physiology:

  • GPR39 knockout in mice leads to:

    • Reduced vascular fibrosis

    • Enhanced endothelium-dependent vasodilation

    • Inhibition of endothelial inflammation

    • Decreased oxidative stress

    • Reduced endothelial apoptosis

Molecular Mechanisms:

  • GPR39 regulates NOD-like receptor protein 3 (Nlrp3) gene expression

  • Nlrp3 activation counteracts the beneficial effects of GPR39 knockout

  • Creates a potential mechanistic link between GPR39 and inflammasome activation

Therapeutic Applications:

  • Structure-based high throughput virtual screening has identified potential GPR39 ligands

  • The small molecule Z1780628919 reduces Ang II-induced hypertension

  • Improves vascular function in experimental models

  • Represents a novel therapeutic approach for hypertension treatment

Experimental Models and Readouts:

  • Blood pressure measurements in GPR39 knockout mice with Ang II infusion

  • Vascular reactivity studies in isolated vessels

  • Histological assessment of vascular fibrosis

  • Measurement of inflammatory markers in vascular tissue

  • Evaluation of endothelial function through multiple methodologies

These findings position GPR39 as a promising target for antihypertensive therapies with direct vascular protective effects beyond blood pressure reduction.

What are the best approaches for analyzing GPR39-ligand interactions and screening for novel modulators?

Researchers investigating GPR39-ligand interactions and seeking novel modulators should consider several complementary approaches:

Structure-Based Methods:

  • High-throughput virtual screening (HTVS) has successfully identified small molecule ligands like Z1780628919

  • Consider separate screening campaigns for the zinc-binding site versus bile acid binding regions

  • Molecular docking using homology models based on related GPCRs

  • Fragment-based screening approaches may identify novel chemical scaffolds

Functional Screening Assays:

  • Calcium mobilization assays in recombinant systems

  • BRET/FRET-based conformational change assays

  • G-protein coupling assays (GTPγS binding, BRET-based G protein dissociation)

  • β-arrestin recruitment assays

  • Pathway-specific reporter systems (SRE, NF-κB activation)

Biophysical Interaction Analysis:

  • Surface plasmon resonance (SPR) with purified receptor

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Microscale thermophoresis for detecting interactions in solution

  • Hydrogen-deuterium exchange mass spectrometry for mapping binding interfaces

Data Analysis Approaches:

  • Calculate Receptor Activity Index (RAi) values as described in search result :

    • Divide efficacy (Emax) by EC50 for each compound

    • Normalize to maximum value among tested compounds

    • Take logarithm (Log10) of normalized values

    • Set ambiguous EC50 values (>100 μM or >200 μM) as 200 μM

    • Set normalized RAi values <0.001 as 0.001

    • Calculate separate RAi values in presence/absence of zinc

These methodologies provide complementary information about GPR39-ligand interactions and can be combined for comprehensive characterization of novel modulators.

How can researchers differentiate between GPR39 and GPBAR1 mediated effects in bile acid signaling?

Differentiating between GPR39 and GPBAR1 (another bile acid receptor) effects is crucial for accurate interpretation of experimental results:

Genetic Approaches:

  • Utilize both Gpr39−/− and Gpbar1−/− mouse models

  • Compare responses in single knockout versus wild-type animals

  • Consider generating double knockout models for comprehensive analysis

Pharmacological Tools:

  • Use selective GPBAR1 agonists like INT-777 as control compounds

  • Test bile acids with differential selectivity profiles for GPR39 versus GPBAR1

  • Compare calcium signaling responses (GPR39-dominant) versus cAMP responses (GPBAR1-dominant)

Signaling Pathway Discrimination:

  • GPR39 primarily signals through calcium mobilization and Gq pathways

  • GPBAR1 predominantly couples to Gs and increases cAMP

  • Measure both calcium and cAMP responses in parallel experiments

Response Pattern Analysis:

Response MeasuredGPR39-MediatedGPBAR1-MediatedHow to Differentiate
Calcium signalingStrongWeak/IndirectCompare in Gpr39−/− vs. Gpbar1−/− cells
cAMP productionMinimalStrongCompare INT-777 vs. bile acid responses
Amylase secretionPresentLess importantCompare in Gpr39−/− vs. Gpbar1−/− acinar cells
Cell injury/deathCritical mediatorLess importantCompare PI uptake/LDH release in knockout models

Key Experimental Observations:

  • Calcium elevation induced by LCAS or TLCAS is essentially absent in Gpr39−/− cells

  • While calcium signaling is decreased in Gpbar1−/− cells, it remains significantly higher than in Gpr39−/− cells

  • GPBAR1 agonist INT-777 does not induce calcium elevation in acinar cells

  • Amylase discharge induced by LCAS is reduced in Gpbar1−/− cells but still higher than in Gpr39−/− cells

These approaches allow researchers to clearly distinguish GPR39-specific effects from those mediated by GPBAR1 in bile acid signaling studies.

What are the most promising therapeutic applications for GPR39 modulators based on current research?

Based on the reviewed research, several therapeutic applications for GPR39 modulators show particular promise:

Diabetes and Metabolic Disorders:

  • GPR39 agonists may enhance glucose-stimulated insulin secretion

  • GPR39's role in glucose homeostasis suggests potential in treating certain forms of diabetes

  • Connection to MODY genes (HNF-1α and HNF-4α) indicates relevance to monogenic diabetes forms

Hypertension and Vascular Protection:

  • Small molecule GPR39 modulators like Z1780628919 reduce Ang II-induced hypertension

  • GPR39 targeting improves vascular function beyond blood pressure effects

  • Potential for treating hypertension with prominent vascular dysfunction

Acute Pancreatitis:

  • GPR39 antagonists may protect against bile acid-induced acute pancreatitis

  • Knockout studies show reduced inflammation and necrosis in experimental models

  • Could address an important unmet need in pancreatitis treatment

Cytoprotective Applications:

  • GPR39 activation protects against oxidative, ER, and mitochondrial stress

  • Potential applications in conditions with excessive cell death

  • May be relevant to ischemia-reperfusion injury and neurodegenerative diseases

Wound Healing and Tissue Repair:

  • GPR39 plays a role in epithelial repair and wound healing

  • Activation increases production of cytokines including IL6

  • Potential for dermatological applications

These diverse therapeutic applications reflect GPR39's multifunctional nature and tissue-specific effects. The development of selective modulators with appropriate pharmacokinetic properties represents a significant opportunity for translational research in these areas.

What are the current limitations and knowledge gaps in GPR39 research that require further investigation?

Despite significant advances, several important knowledge gaps in GPR39 research warrant further investigation:

Structural Biology:

  • Lack of high-resolution crystal or cryo-EM structures of human GPR39

  • Incomplete understanding of the precise binding sites for different ligands

  • Need for structural characterization of GPR39 in complex with various ligands and G proteins

Physiological Ligands:

  • Uncertainty regarding the primary endogenous ligand(s) beyond zinc and bile acids

  • Relative physiological importance of zinc versus bile acid signaling in different tissues

  • Potential existence of additional unidentified ligands

Signaling Mechanisms:

  • Incomplete characterization of G-protein coupling preferences in different tissues

  • Limited understanding of biased signaling through GPR39

  • Need for better delineation of heteroreceptor complex signaling mechanisms

Tissue-Specific Functions:

  • Variance in GPR39 function across different tissues requires further investigation

  • Limited understanding of GPR39 roles in tissues beyond pancreas and vasculature

  • Need for tissue-specific knockout models to clarify context-dependent functions

Translational Challenges:

  • Limited availability of selective, potent, and bioavailable GPR39 modulators

  • Uncertainty regarding potential side effects of GPR39 targeting given its wide expression

  • Need for better understanding of species differences in GPR39 function

Technical Limitations:

  • Lack of validated antibodies for consistent detection across applications

  • Challenges in recombinant expression and purification for structural studies

  • Limited availability of selective pharmacological tools for in vivo studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.