Recombinant Human G-protein coupled receptor 3 (GPR3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific requirements may exist. Should you need a particular format, please clearly indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for accurate delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please notify us in advance, and additional fees will be applied.
Notes
Repeated freezing and thawing of the product is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
While the tag type is determined during production, if you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
GPR3; ACCA; G-protein coupled receptor 3; ACCA orphan receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENAL VVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAF TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDG LTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYV ATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFR NQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
Uniprot No.

Target Background

Function
GPR3 is an orphan receptor exhibiting constitutive G(s) signaling activity, leading to the activation of cyclic AMP. It potentially plays a role in modulating various brain functions, including behavioral responses to stress, amyloid-beta peptide generation in neurons, and neurite outgrowth. It also contributes to the maintenance of meiotic arrest in oocytes.
Gene References Into Functions
  1. Research findings indicate that GPR3 signals at the plasma membrane and its activity can be suppressed by GRK2/beta-arrestin overexpression. These results strongly suggest the involvement of serine and/or threonine residues in the third intracellular loop in regulating GPR3 activity. PMID: 23826079
  2. Gpr3 stimulates Abeta production through interactions with APP and beta-arrestin2. PMID: 24069330
  3. GPR3 is a key factor in the regulation of the nervous system and follicle development.[review] PMID: 23732663
  4. GPR3 is expressed in the ovary and testes, and plays a crucial role in regulating meiosis in mice. PMID: 15591206
  5. Mutations in GPR3 are not a common cause of premature ovarian failure in Chinese women. PMID: 20158988
  6. GPR3 controls gene expression in vascular endothelial cells in the presence of fluid shear stress, classifying it as a sphingosine 1-phosphate receptor. PMID: 12649592
  7. Our research concludes that perturbations in GPR3 are not a common cause of POF in this specific population. PMID: 17953967

Show More

Hide All

Database Links

HGNC: 4484

OMIM: 600241

KEGG: hsa:2827

STRING: 9606.ENSP00000363136

UniGene: Hs.66542

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in the central nervous system, and at low levels in the lung, kidney, testis, ovary and eye. Highly expressed in regions of the brain implicated in the Alzheimer disease.

Q&A

What is GPR3 and where is it primarily expressed?

GPR3 (G Protein-Coupled Receptor 3) is a member of the G protein-coupled receptor family characterized by a seven transmembrane domain motif. It is predominantly expressed in mammalian brain (specifically in the CA1, CA2, and CA3 regions of the hippocampus, layers V and VI of the cortex, and the habenula) and in oocytes . As a constitutively active receptor, GPR3 maintains high levels of 3'-5'-cyclic adenosine monophosphate (cAMP) without requiring ligand binding, allowing it to play roles in several physiological processes including meiotic arrest in oocytes and neuronal development .

What are the primary signaling pathways associated with GPR3?

GPR3 primarily signals through G protein (Gαs)-coupled pathways, constitutively activating adenylate cyclase to maintain elevated cAMP levels . Beyond this canonical pathway, GPR3 also mediates several other signaling mechanisms including Ca²⁺ mobilization, β-arrestin2 recruitment and receptor desensitization . These pathways can be independently manipulated, as demonstrated in G protein-biased GPR3 mouse models where G protein signaling is maintained while β-arrestin signaling is eliminated . GPR3 signaling activates multiple downstream pathways including PKA, ERK, and PI3K-mediated signaling, which are particularly important for its role in stimulating neurite outgrowth in cerebellar granular neurons .

What diseases and physiological functions are associated with GPR3?

GPR3 has been implicated in several diseases and physiological functions:

  • Alzheimer's Disease: GPR3 levels are elevated in a subset of Alzheimer's disease patients, and it modulates amyloid-β (Aβ) generation. Genetic deletion of Gpr3 attenuates Aβ pathology in multiple AD mouse models .

  • Pituitary Disorders: GPR3 is associated with Pituitary Adenoma 2 and Growth Hormone-Secreting tumors .

  • Neurological Conditions: It has connections to Lennox-Gastaut Syndrome and plays roles in behavioral responses to stress .

  • Reproductive Biology: GPR3 is crucial for meiotic arrest in oocytes, with Gpr3-deficient mice showing reduced fertility .

  • Thermogenesis: GPR3 acts as an essential activator of thermogenic adipocytes and drives thermogenesis via its intrinsic G(s)-coupling activity .

How can recombinant GPR3 be effectively expressed for functional studies?

For functional studies of recombinant GPR3, researchers have successfully employed human embryonic kidney 293 (HEK293) cell lines stably expressing FLAG-GPR3-green fluorescent protein constructs . This approach enables:

  • Protein Detection: The FLAG tag and GFP fusion allow for easy detection and localization studies.

  • Functional Assays: This system permits measurement of cAMP accumulation using homogeneous time-resolved fluorescence cAMP assays to assess constitutive activity and ligand-induced responses .

  • Signaling Studies: The system can be used to monitor multiple GPR3-mediated pathways, including Ca²⁺ mobilization, cAMP accumulation, and β-arrestin2 recruitment .

When establishing such expression systems, researchers should consider the high constitutive activity of GPR3, which may affect baseline measurements. Appropriate controls including mock-transfected cells are essential for accurate interpretation of results.

What methods are available for studying GPR3 ligand interactions and screening?

Several methodological approaches have proven effective for identifying and characterizing GPR3 ligands:

  • Homogeneous Time-Resolved Fluorescence (HTRF) cAMP Assay: This has been successfully used to screen chemical libraries for GPR3 ligands, leading to the identification of diphenyleneiodonium chloride (DPI) as a novel GPR3 agonist .

  • Calcium Mobilization Assays: These can detect GPR3-mediated changes in intracellular Ca²⁺ levels in response to potential ligands .

  • β-Arrestin Recruitment Assays: These monitor the membrane recruitment of β-arrestin2 following receptor activation, providing insights into the biased signaling properties of different ligands .

  • Receptor Desensitization Studies: These examine changes in receptor responsiveness following repeated or prolonged exposure to ligands .

When screening for GPR3 ligands, it's important to include assays for cross-reactivity with other GPCRs to establish specificity, as demonstrated in the characterization of DPI, which showed weak or no cross-reactivity with other GPCRs .

What animal models are available for studying GPR3 function in vivo?

Several genetically modified mouse models have been developed for studying GPR3 function:

  • Gpr3 Knockout Mice: Complete deletion of the Gpr3 gene. While these mice show reduced Aβ pathology in AD models, they also display adverse phenotypes including elevated anxiety-like behavior, reduced fertility, memory impairment, and increased sensitivity to neuropathic pain .

  • G Protein-Biased GPR3 Mice: Created using CRISPR/Cas9 genome editing to mutate six serine/threonine residues in the GPR3 C-terminus to phosphorylation-deficient alanine residues (S316A, T317A, S318A, S324A, S326A, and S328A). These mutations selectively eliminate β-arrestin signaling while maintaining G protein signaling .

  • HA-Tagged GPR3 Mice: Feature an HA tag in the N-terminus to determine expression and localization of the GPR3 protein in vivo without affecting receptor function .

These models can be crossed with Alzheimer's disease mouse models (e.g., App NL-G-F) to study the role of GPR3 in AD pathogenesis. When using these models, researchers should consider that:

  • G protein-biased GPR3 mice maintain normal cAMP levels unlike Gpr3 knockout mice

  • These models show different phenotypes regarding anxiety behavior, fertility, and cognitive function

  • The effects on Aβ pathology differ between models, offering insights into the differential roles of G protein and β-arrestin signaling

How does the constitutive activity of GPR3 differ from ligand-activated GPCRs?

GPR3 exhibits high constitutive (basal) activity, activating G protein-coupled pathways without requiring ligand binding. This distinctive characteristic differs from conventional ligand-activated GPCRs in several ways:

  • Constant Signaling: GPR3 maintains elevated cAMP levels through constitutive activation of adenylate cyclase via Gαs-coupling, even in the absence of an extracellular ligand .

  • Receptor Dynamics: Recent large-scale molecular dynamics studies of GPCRs have revealed that receptors like GPR3 undergo extensive local "breathing" motions on a nano- to microsecond timescale. These motions contribute to basal receptor activity without ligand presence .

  • Structural Flexibility: The intracellular receptor side of GPR3 shows significant conformational flexibility, which allows it to maintain G protein coupling in the absence of agonist binding .

From a methodological perspective, studying constitutively active receptors like GPR3 requires careful experimental design with appropriate controls to distinguish between ligand-independent activity and ligand-induced effects. Researchers should account for high baseline signaling when designing assays to detect changes induced by potential modulators.

What is known about biased signaling in GPR3 and how can it be experimentally manipulated?

Biased signaling in GPR3 refers to the selective activation of G protein or β-arrestin pathways. Research has demonstrated:

  • Differential Pathway Effects: GPR3-mediated G protein signaling appears crucial for maintaining normal anxiety levels, fertility, and cognitive function, while β-arrestin signaling is implicated in amyloid-β generation .

  • Genetic Manipulation Approaches: CRISPR/Cas9 genome editing has been used to create G protein-biased GPR3 mouse models by mutating six serine/threonine residues in the receptor's C-terminus to alanine residues. This prevents β-arrestin recruitment while maintaining G protein signaling .

Experimental methods to study biased signaling include:

  • Pathway-Specific Assays: G protein activation can be measured through cAMP accumulation assays, while β-arrestin recruitment can be assessed via fluorescently tagged β-arrestin translocation assays .

  • Comparative Phenotyping: Comparing phenotypes between wild-type, complete knockout, and pathway-biased models helps distinguish the roles of different signaling cascades. For instance, G protein-biased GPR3 mice maintain normal cAMP levels and do not display the adverse phenotypes seen in Gpr3 knockout mice .

  • Ligand Discovery: Screening for biased ligands that preferentially activate one pathway over another, as has been done with the identification of DPI as a GPR3 agonist with distinct pathway activation profiles .

How do membrane lipids interact with GPR3 and affect its function?

Recent molecular dynamics research on GPCRs has revealed important interactions between membrane lipids and receptors like GPR3:

  • Lipid Insertions: Membrane lipids can penetrate into the receptor core of GPCRs. These "lipid insertions" are not only frequent but also topographically conserved across receptor subtypes .

  • Allosteric Modulation: These lipid insertions can serve as valuable markers for membrane-exposed allosteric pockets and may modulate receptor function by affecting conformational dynamics .

  • Lateral Entrance Gates: Lipid dynamics can expose lateral entrance gateways for ligands, providing alternative binding routes beyond the extracellular approach .

For researchers studying GPR3, consideration of the lipid environment is crucial. Methodological approaches include:

  • Molecular Dynamics Simulations: These can capture the inherent flexibility of GPCRs and their interactions with membrane lipids, revealing significant "breathing" motions and lipid insertion events .

  • Membrane Mimetic Systems: When designing expression systems or reconstituting purified GPR3, the lipid composition should be carefully considered as it may affect receptor conformation and function.

  • Lipid-Protein Interaction Analysis: Techniques such as mass spectrometry following crosslinking or hydrogen-deuterium exchange can identify specific lipid-binding sites on GPR3.

What evidence links GPR3 to Alzheimer's disease pathogenesis?

Multiple lines of evidence connect GPR3 to Alzheimer's disease (AD) pathology:

  • Expression Changes: GPR3 levels are elevated in a subset of patients with Alzheimer's disease .

  • Amyloid-β Modulation: GPR3 has been identified as a key modulator of γ-secretase activity, which is critical for amyloid-β (Aβ) peptide generation .

  • Genetic Evidence: Genetic deletion of Gpr3 leads to significant reduction in Aβ pathology and alleviation of cognitive deficits in multiple AD transgenic mouse models .

  • Pathway-Specific Effects: Research using G protein-biased GPR3 signaling models demonstrates that selective elimination of β-arrestin signaling reduces soluble Aβ levels and decreases both the area and compaction of amyloid plaques in AD mouse models .

  • Neuroinflammatory Impact: G protein-biased GPR3 signaling in AD mice alters the neuroinflammatory state of microglia and astrocytes, promoting microglial and astrocytic hypertrophy that may limit amyloid plaque development .

These findings collectively suggest that GPR3 represents a promising therapeutic target for AD, with particular emphasis on biased signaling approaches that could reduce Aβ pathology while preserving beneficial physiological functions.

How can GPR3-targeted approaches be developed as potential Alzheimer's disease therapeutics?

Development of GPR3-targeted therapeutics for Alzheimer's disease should consider several methodological approaches:

  • Biased Ligand Development: Rather than complete inhibition of GPR3, which leads to adverse phenotypes including anxiety-like behavior and cognitive deficits, research supports developing G protein-biased modulators that selectively block β-arrestin signaling while preserving G protein pathways .

  • Structure-Based Drug Design: Knowledge of GPR3's conformational dynamics and identification of allosteric binding sites can guide the rational design of biased modulators .

  • Phenotypic Screening: Assays that measure Aβ production, neuroinflammatory responses, and GPR3 signaling pathway activation can be employed to identify compounds with desired activity profiles .

Research findings supporting this approach include:

  • G protein-biased GPR3 mice show reduced Aβ levels and altered amyloid plaque characteristics without displaying the adverse phenotypes seen in complete Gpr3 knockout mice .

  • These mice exhibit robust microglial and astrocytic hypertrophy, suggesting a protective glial response that may limit amyloid plaque development .

The development pipeline should include:

  • In vitro screening for pathway-specific modulators

  • Validation in primary neuronal cultures

  • Testing in appropriate AD mouse models

  • Assessment of both amyloid pathology and behavioral outcomes

What methodological approaches can be used to study GPR3's effects on neuroinflammation in Alzheimer's disease?

Investigating GPR3's role in neuroinflammation, particularly in the context of Alzheimer's disease, requires specialized methodological approaches:

  • Glial Cell Analysis: Studies have shown that G protein-biased GPR3 signaling leads to robust microglial and astrocytic hypertrophy, suggesting a protective glial response that may limit amyloid plaque development . Researchers can employ:

    • Immunohistochemical methods to assess microglial/astrocyte morphology and activation state

    • Flow cytometry to quantify inflammatory cell populations

    • Single-cell RNA sequencing to characterize glial transcriptional profiles

  • Amyloid Plaque Characterization: G protein-biased GPR3 signaling has been shown to decrease the area and increase the compaction of amyloid plaques . Methods to assess these changes include:

    • Thioflavin S or antibody-based staining for plaque visualization

    • Quantitative image analysis to measure plaque area, number, and compaction

    • Correlation of plaque characteristics with glial proximity and morphology

  • Inflammatory Biomarker Assessment: Measurement of pro- and anti-inflammatory cytokines, chemokines, and other inflammatory mediators in:

    • Brain tissue homogenates

    • CSF and plasma samples

    • Conditioned media from primary glial cultures

  • In Vivo Models: Comparison of neuroinflammatory responses across:

    • Wild-type mice

    • Complete Gpr3 knockout mice

    • G protein-biased GPR3 mice

    • These models crossed with appropriate AD mouse lines

When designing such studies, researchers should consider the temporal relationship between GPR3 modulation, glial activation, and changes in amyloid pathology, as these processes may have different kinetics and causal relationships.

How does GPR3 structural flexibility affect drug discovery approaches?

Recent large-scale molecular dynamics studies of GPCRs have revealed important insights about receptor flexibility that impact GPR3 drug discovery:

  • Conformational "Breathing": GPCRs, including GPR3, exhibit extensive local "breathing" motions on a nano- to microsecond timescale. These dynamics provide access to numerous previously unexplored receptor conformational states .

  • Allosteric Site Dynamics: Receptor flexibility significantly impacts the shape of allosteric drug binding sites, which frequently adopt partially or completely closed states in the absence of a molecular modulator .

  • Antagonist Stabilization: Receptor flexibility is consistently reduced when the receptor is bound to antagonists, inverse agonists, or negative allosteric modulators (NAMs), stabilizing the closed (inactive-like) state .

Methodological implications for drug discovery include:

  • Ensemble-Based Virtual Screening: Rather than using a single static structure, drug discovery campaigns should employ multiple receptor conformations captured from molecular dynamics simulations.

  • Allosteric Site Identification: Exploring membrane lipid dynamics and their interaction with GPR3 can efficiently expose hidden allosteric sites and lateral ligand entrance gateways .

  • Dynamic Pharmacophore Models: Development of pharmacophore models that account for receptor flexibility and conformational transitions to better predict ligand binding.

What are the challenges in developing selective modulators for GPR3?

Developing selective modulators for GPR3 faces several significant challenges:

  • Constitutive Activity: GPR3's high basal activity complicates the design of assays to detect modulatory effects and may create a narrow window for detecting activating compounds .

  • Receptor Promiscuity: GPCRs often recognize multiple ligands, and ligands frequently interact with multiple receptors. Ensuring selectivity requires comprehensive cross-reactivity testing against related receptors, particularly GPR6, an important paralog of GPR3 .

  • Biased Signaling Complexity: Developing compounds with specific biased signaling profiles (G protein vs. β-arrestin) adds another layer of complexity to the screening and optimization process .

  • Brain Penetration: For CNS indications like Alzheimer's disease, compounds must cross the blood-brain barrier, adding physicochemical constraints to drug design.

Methodological approaches to address these challenges include:

  • Multiple Orthogonal Assays: Employing pathway-specific assays (G protein activation, β-arrestin recruitment) alongside functional readouts (e.g., neurite outgrowth, Aβ production).

  • Structure-Activity Relationship Studies: Systematic chemical modifications to optimize selectivity profiles once lead compounds like DPI are identified .

  • Target Engagement Biomarkers: Development of PET ligands or other tools to confirm target engagement and brain penetration in vivo.

How do advanced genetic approaches contribute to understanding GPR3 function in disease models?

Advanced genetic approaches have significantly advanced our understanding of GPR3 function:

  • CRISPR/Cas9 Genome Editing: This technology has enabled precise modification of the endogenous GPR3 gene to create G protein-biased signaling models. Specifically, mutation of six serine/threonine residues in the GPR3 C-terminus to alanine residues (S316A, T317A, S318A, S324A, S326A, and S328A) selectively eliminates β-arrestin signaling while maintaining G protein signaling .

  • Pathway Dissection: Comparison of complete Gpr3 knockout with pathway-selective mutants reveals that:

    • G protein signaling is essential for maintaining normal anxiety levels, fertility, and cognitive function

    • β-arrestin signaling contributes to Aβ generation and plaque formation

    • Selective elimination of β-arrestin signaling reduces AD pathology without adverse effects

  • Combined Disease Models: Crossing GPR3 mutant mice with AD mouse models (e.g., App NL-G-F) allows investigation of how specific signaling pathways affect disease progression .

Methodological considerations for researchers employing these approaches include:

  • Verification of Target Modification: Confirming the intended genetic modifications at both DNA and protein levels, while ensuring mRNA expression levels remain unchanged .

  • Off-Target Analysis: Screening for potential off-target effects of CRISPR/Cas9 editing through whole-genome sequencing or targeted analysis of predicted off-target sites .

  • Comprehensive Phenotyping: Assessing multiple physiological and behavioral parameters to fully understand the consequences of genetic modifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.