Recombinant Human G-protein coupled receptor 4 (GPR4)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Biochemical Properties

GPR4 belongs to the G-protein coupled receptor (GPCR) superfamily, characterized by seven transmembrane domains that facilitate signal transduction across cell membranes. The human GPR4 protein consists of 362 amino acids and functions primarily as a pH sensor in various cell types . In recombinant form, the protein is typically expressed with affinity tags such as the N-terminal 10xHis-tag to facilitate purification and detection . The full amino acid sequence of human GPR4 has been well-characterized, displaying significant conservation across mammalian species, which suggests important evolutionary functional constraints.

Signaling Mechanisms and Functional Properties

GPR4 couples predominantly to Gs proteins, leading to the activation of adenylyl cyclase and subsequent accumulation of cyclic adenosine monophosphate (cAMP) . This signaling pathway is critical for mediating GPR4's responses to extracellular pH changes. Interestingly, GPR4 exhibits high constitutive activity at neutral pH, with only modest increases in cAMP production observed as the environment becomes more acidic . This unique property distinguishes GPR4 from many other pH-sensing receptors and suggests a specialized role in maintaining cellular homeostasis under varying acidic conditions.

pH-Dependent Activation Profile

Studies in HEK293 cells overexpressing GPR4 have demonstrated that the receptor is highly constitutively active at neutral pH, with only slight additional increases in cAMP accumulation as pH decreases . In contrast, human vascular endothelial cells (HUVEC) that natively express GPR4 show a more pronounced response to physiological acidification. When the pH changes from 7.4 to 7.0, HUVEC cells exhibit approximately a 55% increase in cAMP levels, which can be completely prevented by treatment with 1 μM of the GPR4 antagonist NE 52-QQ57 .

The level of GPR4 expression significantly impacts its pH sensitivity, with overexpression potentially masking the full dynamic range of the receptor's response to acidification. This observation highlights the importance of studying the receptor in native expression contexts to accurately characterize its physiological functions. The differences in activation profiles between recombinant systems and native cells underscore the complex regulation of GPR4 activity in vivo.

Modulation by Physiological Factors

L-lactic acid, a primary extracellular organic acid, has been shown to suppress the pH-dependent activation of GPR4 in both HEK293 cells and HUVEC at concentrations ranging from 1 to 10 mM . This suggests that L-lactic acid functions as an allosteric negative modulator of GPR4 activity. This interaction is particularly significant considering that lactic acid accumulation frequently accompanies tissue acidosis in various physiological and pathological conditions, potentially providing a feedback mechanism to regulate GPR4 signaling.

GPR4 activity can also be effectively blocked by specific antagonists. The compound NE 52-QQ57 has demonstrated potent inhibition of GPR4-mediated cAMP accumulation with an IC50 of 26.8 nM in HEK293 cells . This high-affinity antagonist represents a valuable tool for investigating GPR4 function in both in vitro and in vivo settings, enabling selective inhibition of receptor activity without affecting related pH-sensing mechanisms.

Tissue Distribution and Physiological Roles

GPR4 exhibits a distinct expression pattern across various tissues and cell types, which provides insights into its diverse physiological functions. Using advanced techniques such as knock-in mouse models and RNAscope in situ hybridization, researchers have identified abundant GPR4 expression in the cerebrovascular endothelium and specific neuronal populations . This distribution pattern suggests important roles in neurovascular function, central respiratory control, and acid-base homeostasis.

Central Nervous System Expression

Within the central nervous system, GPR4 is prominently expressed in neurons of several key regulatory regions, including the dorsal raphe, retrotrapezoid nucleus (RTN), locus coeruleus, and lateral septum . The presence of GPR4 in these areas suggests involvement in crucial functions such as mood regulation, arousal, and respiratory control. Particularly notable is GPR4 expression in RTN neurons, which are known to be central chemoreceptors responsible for detecting changes in CO2/H+ levels and modulating respiratory responses accordingly.

There has been some controversy regarding the localization of GPR4 in the brain, with some studies detecting expression primarily in neurons while others have demonstrated its presence in cerebrovascular endothelium . Current consensus based on multiple methodologies suggests that GPR4 is expressed in both neuronal populations and brain endothelial cells, though the relative expression levels may vary across different brain regions. This dual localization may allow GPR4 to coordinate neuronal and vascular responses to pH changes in the central nervous system.

Peripheral Tissue Expression and Function

Beyond the central nervous system, GPR4 is significantly expressed in vascular endothelial cells throughout the body, including human umbilical vein endothelial cells (HUVEC) . In these cells, GPR4 activation has been implicated in multiple processes including blood vessel formation, transmigration of monocytes, responses to vascular endothelial growth factor, vascular inflammation, and endothelial adhesiveness . These functions highlight GPR4's importance in regulating vascular physiology and its potential involvement in various vascular pathologies.

Strong GPR4 expression has also been detected in the kidney, where it contributes to the regulation of acid-base balance . Given the kidney's central role in maintaining systemic pH homeostasis, GPR4 may serve as a key sensor for detecting changes in urinary or interstitial pH and triggering appropriate compensatory responses. This function aligns with GPR4's established role as a proton sensor and suggests potential applications in understanding and treating acid-base disorders.

Role in Pathophysiological Processes

The proton-sensing capabilities of GPR4 position it as a significant factor in diseases characterized by dysregulated pH environments. Research has demonstrated GPR4's involvement in cancer progression, particularly in promoting angiogenesis under acidic conditions which commonly occur in tumor microenvironments. Additionally, GPR4's expression in vascular endothelium and role in inflammatory processes suggest potential contributions to cardiovascular and inflammatory diseases.

Cancer and Tumor Angiogenesis

Studies focusing on squamous cell carcinoma of the head and neck (SCCHN) have revealed that GPR4 overexpression in cancer cells significantly increases the expression and secretion of IL6, IL8, and VEGFA under acidic conditions (pH 5.9) . These pro-inflammatory cytokines and growth factors promote angiogenesis, which is essential for tumor growth and metastasis. The effect of GPR4 on cytokine production was found to be mediated by the p38 MAPK signaling pathway, as treatment with the p38 inhibitor SB203580 blocked the GPR4-induced increase in IL6, IL8, and VEGFA expression .

In vitro tube formation assays have demonstrated that conditioned medium from GPR4-overexpressing SCCHN cells significantly enhances tube formation by human microvascular endothelial cells (HMEC-1) compared to control cells at pH 5.9 . This effect was diminished when neutralizing antibodies against IL6, IL8, and VEGFA were added to the conditioned medium, confirming the role of these factors in GPR4-mediated angiogenesis. In vivo studies using the chick chorioallantoic membrane (CAM) model further validated these findings, showing that GPR4-infected SCCHN cells recruited more vasculature than control cells when exposed to acidic pH .

Respiratory Physiology and Pathology

GPR4 has been implicated in central respiratory sensitivity to CO2, suggesting a role in respiratory regulation under normal and pathological conditions . In unanaesthetized mice and rats, administration of the GPR4 antagonist NE 52-QQ57 (20 mg/kg) reduced ventilatory responses to 5% and 10% CO2, indicating that GPR4 activity contributes to hypercapnic respiratory drive . Interestingly, this effect was absent in anesthetized animals, potentially due to the inhibitory effect of lactate on GPR4 under anesthesia.

The expression of GPR4 in RTN neurons, which are known to be central to respiratory chemoreception, further supports its role in breathing regulation. Since RTN neurons respond to changes in CO2/H+ levels and adjust respiratory output accordingly, GPR4 may serve as one of the molecular sensors that enable these neurons to detect acid-base disturbances. This function has significant implications for understanding and potentially treating respiratory disorders characterized by abnormal chemosensitivity, such as central sleep apnea and certain chronic obstructive pulmonary diseases.

Pharmacological Targeting and Therapeutic Potential

The unique properties and physiological roles of GPR4 make it an attractive target for pharmacological intervention in various disease states. Several compounds have been developed that modulate GPR4 activity, with the GPR4 antagonist NE 52-QQ57 being particularly well-characterized. Understanding the pharmacokinetics, tissue distribution, and specific effects of these compounds is essential for translating GPR4 research into clinical applications.

GPR4 Antagonists and Their Effects

NE 52-QQ57 has emerged as a potent and selective GPR4 antagonist, with an IC50 of 26.8 nM for inhibition of GPR4-mediated cAMP accumulation in HEK293 cells . This compound effectively blocks the pH-dependent activation of GPR4 in both recombinant systems and cells that natively express the receptor. In HUVEC cells, 1 μM NE 52-QQ57 completely prevented the cAMP increase induced by physiological acidification (pH 7.4 to 7.0) .

Potential Therapeutic Applications

Based on its involvement in tumor angiogenesis, GPR4 represents a potential target for cancer therapy, particularly for tumors characterized by acidic microenvironments. Inhibiting GPR4 could potentially reduce tumor-associated angiogenesis by preventing the acid-induced production of pro-angiogenic factors such as IL6, IL8, and VEGFA . This approach might be especially relevant for squamous cell carcinoma of the head and neck and other cancers where acid-base dysregulation contributes to disease progression.

The role of GPR4 in respiratory CO2 sensitivity suggests potential applications in breathing disorders. While inhibiting GPR4 reduces hypercapnic respiratory drive, which might be detrimental in some conditions, selective modulation of GPR4 activity could be beneficial in disorders characterized by excessive respiratory sensitivity to CO2. The differential effects of GPR4 antagonism under various physiological states (e.g., conscious vs. anesthetized) highlight the complexity of targeting this receptor and the need for context-specific approaches.

Technical Considerations for Research Applications

Working with recombinant GPR4 requires specific technical considerations to maintain protein stability and functionality. These include proper handling, storage, and experimental design to account for the unique properties of this transmembrane protein. Understanding these technical aspects is essential for researchers utilizing recombinant GPR4 in their studies.

Experimental Design Considerations

When designing experiments involving GPR4, several factors should be considered to obtain reliable and physiologically relevant results. The level of GPR4 expression significantly impacts its pH sensitivity, with overexpression potentially altering the receptor's normal response profile . Therefore, comparisons between recombinant overexpression systems and cells with native GPR4 expression should be interpreted carefully.

The presence of endogenous modulators such as L-lactic acid can affect GPR4 activity and should be accounted for in experimental designs . Similarly, the pH of the experimental medium should be carefully controlled and monitored, as even small changes can influence GPR4 signaling. For in vivo studies, the state of consciousness (anesthetized vs. unanesthetized) appears to influence GPR4-mediated responses, possibly due to changes in metabolic parameters that affect endogenous modulators .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
GPR4; G-protein coupled receptor 4; G-protein coupled receptor 6C.l; GPR6C.l
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLS IADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVA HPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAW MNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKAKIKRLALSLIAIVLVCFAPY HVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKA LHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQGDQVQLKMLPP AQ
Uniprot No.

Target Background

Function
GPR4, a proton-sensing G-protein coupled receptor, engages with multiple intracellular signaling pathways, including GNAS/cAMP, GNAQ/phospholipase C (PLC), and GNA12/GNA13/Rho pathways. Acidosis-induced GPR4 activation enhances paracellular gap formation and permeability in vascular endothelial cells via the GNA12/GNA13/Rho GTPase signaling pathway. In the brain, it may mediate central respiratory sensitivity to CO₂/H⁺.
Gene References Into Functions
  1. Proton-sensing GPR4 signaling mediates proton-induced inhibition of BMSC osteogenesis. YAP serves as a downstream effector of GPR4 signaling. Extracellular pH modulates BMSC osteogenic responses by regulating the GPR4-YAP pathway. PMID: 27256071
  2. zOGR1, unlike GPR4, functions as a metal-sensing G-protein-coupled receptor in addition to its proton-sensing capabilities, although not all metals activating hOGR1 also activate zOGR1. PMID: 28270026
  3. GPR4 blockade attenuates renal injury post-IR and reduces cell apoptosis by suppressing CHOP expression. PMID: 29089376
  4. Acidosis/GPR4-induced endoplasmic reticulum stress pathways in endothelial cells may regulate vascular growth and inflammatory responses in acidic microenvironments. PMID: 28134810
  5. GPR4 influences endothelial cells by regulating Notch1, a crucial function in physiological and pathological angiogenesis. PMID: 27279286
  6. GPR4 induces angiogenesis via p38-mediated IL6, IL8, and VEGFA secretion at acidic extracellular pH in head and neck squamous cell carcinoma. PMID: 27078157
  7. GPR4 plays a significant role in epithelial ovarian carcinoma (EOC) development, with overexpression potentially driving angiogenesis, tumor growth, and metastasis. PMID: 23888957
  8. Acidosis/GPR4 signaling regulates endothelial cell adhesion primarily through the G(s)/cAMP/Epac pathway. PMID: 22110680
  9. Mutating histidine residues (79, 165, or 269) in the GPR4 N-terminus to phenylalanine right-shifts the EC₅₀ of proton-induced signaling activities, including cAMP accumulation. PMID: 20211729
  10. Endogenous GPR4 in endothelial cells may function as a G protein-coupled receptor mediating LPC's proinflammatory effects. PMID: 12805023
  11. GPR4, closely related to OGR1, responds to pH changes and stimulates cyclic AMP formation. PMID: 12955148
  12. Sphingosylphosphorylcholine and lysophosphatidic acid are not GPR4 ligands; this receptor may constitutively inhibit ERK1/2 activation. PMID: 14567679
  13. GPR4 and TDAG8 overexpression in human tumors contributes to tumor formation. PMID: 15221007
  14. Sphingosylphosphorylcholine and its receptor, GPR4, are critical regulators of endothelial cell angiogenic potential. PMID: 15857892
  15. GPR4 plays a critical role in lysophosphatidylcholine-activated inflammatory responses. PMID: 16461426
  16. GPR4 in brain endothelial cells regulates monocyte transmigration. PMID: 17364894
  17. Lysophosphatidylcholine receptor GPR4, expressed in YPEN-1 cells, triggers the cAMP/protein kinase A/cAMP response element-binding protein pathway, upregulating adhesion molecules. PMID: 17437524
  18. Previously proposed "ligand-independent" GPR4 signaling is mediated by proton-sensing mechanisms. PMID: 17462861
Database Links

HGNC: 4497

OMIM: 600551

KEGG: hsa:2828

STRING: 9606.ENSP00000319744

UniGene: Hs.17170

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of human GPR4 and what distinguishes it from other GPCRs?

Human GPR4 belongs to the subfamily of proton-sensing G-protein coupled receptors (psGPCRs) that detect pH changes in the extracellular environment and regulate diverse physiological responses. Recent cryo-EM structures reveal that GPR4 has a distinct distribution of histidine and acidic residues at the extracellular region that contribute to its pH-sensing capabilities . Unlike canonical GPCRs, GPR4 exhibits a non-canonical G-protein coupling model, with a gentler outward movement of TM5-TM6 helices (~4 Å compared to inactive models) to accommodate G-protein binding, rather than the more pronounced movements (12-16 Å) seen in other GPCR-Gs complexes .

What is currently known about the pH-sensing mechanism of GPR4?

GPR4 contains a triad of acidic residues within the transmembrane domain that are crucial for proton sensing . Recent structural studies have shown that while these triad residues have significant effects on pH sensing, additional ionizable residues (histidines and acidic residues) at the extracellular region also moderately influence the proton-sensing capacity . Cell-based assays comparing pH activation profiles in recombinant expression systems (HEK293 cells) versus native expression (human vascular endothelium cells) have helped elucidate these mechanisms . Additionally, the orthosteric pocket of GPR4 contains a cluster of aromatic residues that may propagate proton-sensing signals to the intracellular region via repacking of the aromatic patch at the central region .

What expression systems have proven most effective for producing functional recombinant human GPR4?

Based on published research, HEK293 cells have been successfully used for recombinant expression of human GPR4 for functional studies . For structural studies, researchers have utilized heterologous expression systems with appropriate modifications to stabilize the receptor. When designing expression constructs, it's critical to consider the addition of purification tags that don't interfere with receptor function. Common approaches include:

  • Fusion proteins with MBP, GST, or SUMO to improve solubility

  • Addition of histidine tags for metal affinity purification

  • Use of FLAG or HA epitope tags for immunoaffinity purification

For optimal expression, induction conditions should be carefully optimized regarding temperature, induction time, and inducer concentration to balance between protein yield and functional integrity.

What are the critical considerations for maintaining recombinant GPR4 stability during purification?

Maintaining the structural integrity of GPR4 during purification is challenging due to its membrane protein nature. Researchers should consider:

  • Selection of appropriate detergents (e.g., DDM, LMNG) or lipid nanodiscs for solubilization

  • Addition of cholesterol or specific lipids that stabilize the receptor

  • Inclusion of pH buffers appropriate for the intended application (pH 6.5-8.5 range covers most experimental needs)

  • Use of protease inhibitors throughout the purification process

  • Temperature control (typically 4°C) throughout purification steps

Recent structural biology approaches have used zebrafish GPR4 as a model and incorporated stabilizing mutations or fusion proteins to achieve sufficient stability for cryo-EM studies .

How can researchers assess the functionality of purified recombinant GPR4?

After purification, verifying the functionality of recombinant GPR4 is crucial before proceeding with experiments. Methodology includes:

  • Ligand binding assays to confirm proper folding of the binding pocket

  • G protein coupling assays using purified G proteins (particularly Gs for human GPR4)

  • Thermal stability assays to assess protein folding

  • pH-dependent activation profiles measured through cAMP accumulation assays

  • Comparative analysis with native GPR4 activity from endothelial cells or other GPR4-expressing cells

Recombinant GPR4 should demonstrate pH-sensitivity consistent with native receptors, with activation typically occurring in acidic conditions reflecting their role as proton sensors.

What G proteins are known to couple with human GPR4 and how does this coupling differ from other species?

Human GPR4 primarily couples to Gs proteins, activating adenylyl cyclase and increasing cAMP levels . This has been demonstrated in recombinant expression systems and correlates with its pH-sensing function. The G protein coupling interface of GPR4 includes several key polar residues that interact with the α5 helix of Gαs. Specifically, residue R123³·⁵⁰ (using Ballesteros-Weinstein numbering) engages in both a salt bridge with E375^(H5.24) and a π-cation interaction with Y374^(H5.23) of Gαs .

In contrast, GPR4 homologs in fungi, such as in Neurospora crassa, primarily couple to different G proteins. N. crassa GPR-4 couples to GNA-1 in a cAMP signaling pathway that regulates carbon source response, as demonstrated through yeast two-hybrid assays showing physical interaction between the carboxy-terminal fragment of GPR-4 and GNA-1 .

How can researchers experimentally measure GPR4-mediated signaling in cellular systems?

Measuring GPR4-mediated signaling can be accomplished through several complementary approaches:

  • cAMP accumulation assays using luminescence-based reporters (e.g., GloSensor) or ELISA-based detection methods to measure Gs activation

  • Calcium mobilization assays when GPR4 couples to Gq proteins in certain contexts

  • Reporter gene assays utilizing cAMP-responsive elements (CRE) linked to luciferase

  • Phosphorylation detection of downstream targets (e.g., CREB, ERK1/2) by western blotting

  • Real-time measurement of signaling dynamics using FRET-based biosensors for cAMP or G protein activation

When designing these experiments, it's critical to include appropriate controls for pH effects on cellular functions independent of GPR4 activation. This typically involves comparing GPR4-expressing cells with vector-transfected controls across a range of pH conditions .

What are the current models for GPR4-mediated signal transduction in response to pH changes?

Current models of GPR4 pH sensing and signal transduction involve:

  • Protonation of key histidine and acidic residues in the extracellular domain upon exposure to acidic pH

  • Conformational changes in the transmembrane domains, particularly involving the critical triad of acidic residues

  • Rearrangement of a cluster of aromatic residues within the orthosteric pocket that propagates the signal to the intracellular region

  • Repacking of the aromatic patch at the central region of the receptor

  • A modest outward movement of TM5-TM6 helices (~4Å) to create space for G protein binding

The cryo-EM structures of zebrafish GPR4 at both pH 6.5 and 8.5 provide important structural insights into this process, though there are still gaps in understanding the complete dynamic conformational changes during activation .

What are the recommended controls when studying pH-dependent activation of recombinant GPR4?

When investigating pH-dependent activation of recombinant GPR4, researchers should implement the following controls:

  • Vector-only transfected cells to account for endogenous pH-sensing mechanisms

  • pH calibration curves using fluorescent dyes to verify precise extracellular pH during experiments

  • Known GPR4 antagonists to confirm specificity of observed responses

  • Alanine substitution mutants of key residues (e.g., R123³·⁵⁰A) that abolish G protein coupling to distinguish receptor-dependent from receptor-independent effects

  • Parallel assays with other psGPCRs (GPR65, GPR68) to distinguish GPR4-specific responses

  • Consistent buffer compositions differing only in pH to avoid confounding effects from different buffer systems

Careful pH titration experiments (pH 6.0-8.0) should be performed to establish accurate pH50 values, which can serve as baselines for comparing mutants or treatments.

How can mutagenesis approaches be used to investigate GPR4 structure-function relationships?

Targeted mutagenesis has been instrumental in understanding GPR4 structure-function relationships. Effective approaches include:

  • Alanine-scanning mutagenesis of the ionizable residues in the extracellular domain to identify pH-sensing determinants

  • Mutation of the triad of acidic residues in the transmembrane domain to confirm their role in proton sensing

  • Conservative substitutions (e.g., Asp to Glu) to assess the importance of side chain length versus charge

  • Mutation of key G protein-coupling interface residues (e.g., Q53¹·⁶⁰, N58²·³⁷, E59²·³⁸, R137^(ICL2), N219^(ICL3), E226⁶·²⁹) which have been shown to shift pH50 downward by 0.2-0.5 log units

  • Cysteine cross-linking experiments to validate predicted proximity relationships

  • Introduction of fluorescent amino acids at key positions for conformational analysis

Results should be analyzed quantitatively, with pH50 shifts and maximum response values reported to distinguish between effects on ligand potency versus efficacy.

What cell-based assays are most appropriate for studying recombinant GPR4 function in disease-relevant contexts?

For disease-relevant contexts, the following assays are particularly valuable:

  • Endothelial cell models (e.g., HUVECs) that naturally express GPR4 compared with recombinant systems to validate physiological relevance

  • Migration and tube formation assays to assess GPR4's role in angiogenesis

  • Inflammatory cytokine production assays in immune cells with manipulated GPR4 expression

  • Cell adhesion molecule expression analysis in endothelial cells under acidic conditions

  • Co-culture systems with tumor cells and endothelial cells to model tumor microenvironment acidosis

  • Calcium flux and cAMP accumulation assays under hypoxic conditions

When designing these experiments, it's crucial to carefully control environmental parameters beyond pH, including temperature, cell density, passage number, and media composition, as these can significantly influence GPR4-mediated responses.

What techniques have proven successful for determining GPR4 structure, and what are their limitations?

Recent breakthroughs in GPR4 structural biology have primarily utilized cryo-electron microscopy (cryo-EM). The reported structures of active zebrafish GPR4 at pH 6.5 and 8.5 have provided significant insights into the receptor's conformation and G protein coupling . Key methodological considerations include:

  • Protein engineering approaches, including fusion proteins or thermostabilizing mutations

  • Use of model organisms (e.g., zebrafish GPR4) when human proteins prove challenging

  • Complex formation with G proteins to stabilize active conformations

  • Nanobodies or antibody fragments as crystallization chaperones

Limitations of current approaches include:

  • Resolution challenges in membrane protein structures

  • Difficulty capturing transient conformational states during activation

  • Potential artifacts from fusion proteins or stabilizing mutations

  • Challenges in expressing sufficient quantities of functional receptor

Researchers have utilized AlphaFold predictions and previously determined GPCR structures (e.g., A2BR-mini-Gs) as starting models for refinement against electron density maps .

How do recombinant expression systems impact structural studies of GPR4?

The choice of recombinant expression system significantly impacts structural studies of GPR4:

  • Insect cell expression systems (Sf9, Hi5) typically provide higher yields but may have different post-translational modifications

  • Mammalian expression (HEK293, CHO) offers more native-like glycosylation but lower yields

  • Expression host lipid composition affects receptor stability and function

  • Codon optimization for the expression host can dramatically improve protein yields

  • Inducible expression systems allow control over expression timing to limit potential toxicity

For structural studies of zebrafish GPR4, researchers have employed specific refinement approaches including iterative manual adjustments and rebuilding in COOT and phenix.real_space_refine in Phenix .

How do zebrafish GPR4 structures inform our understanding of human GPR4 function?

The zebrafish GPR4 structures have provided valuable insights applicable to human GPR4:

  • Conservation analysis shows that key functional residues are preserved between species

  • Mutagenesis studies demonstrate similar effects on pH sensing and G protein coupling between zebrafish and human GPR4

  • The non-canonical G protein coupling model observed in zebrafish GPR4-Gs structures likely applies to human GPR4

  • The distribution of histidine and acidic residues at the extracellular region that contribute to pH sensing is conserved

What is known about GPR4 expression and function in pathological conditions?

GPR4 has been implicated in several pathological conditions, particularly those involving tissue acidosis:

  • GPR4 is overactivated in acidic tumor microenvironments, potentially contributing to cancer progression

  • GPR4 activation occurs at inflammation sites where local acidosis is a hallmark feature

  • In the central nervous system, GPR4 expression has been mapped using cell lineage tracing mouse models and RNAscope in situ hybridization technology

  • GPR4 expression in vascular endothelial cells suggests roles in vascular inflammation and angiogenesis

Experimental approaches for studying GPR4 in disease contexts include the use of pH-sensitive fluorescent proteins to map microenvironmental pH in conjunction with GPR4 activity measurements, and comparison of recombinant systems with physiologically relevant human vascular endothelium cells (HUVEC) .

How can researchers develop reliable in vitro models to study GPR4 function in acidic microenvironments?

Developing reliable in vitro models for GPR4 function in acidic microenvironments requires careful consideration of several factors:

  • Precise pH control systems using automated titration to maintain stable pH during experiments

  • Microfluidic platforms that can generate defined pH gradients to mimic tissue interfaces

  • 3D culture systems that better recapitulate tissue architecture and allow development of pH gradients

  • Co-culture systems incorporating multiple cell types relevant to specific microenvironments (e.g., endothelial cells with tumor cells or inflammatory cells)

  • Real-time monitoring of both extracellular pH and intracellular signaling using dual reporters

  • Hypoxic culture conditions that naturally generate acidosis through metabolic shifts

Validation should include comparison of recombinant GPR4 responses with those observed in primary cells expressing native receptors to ensure physiological relevance.

What approaches can be used to selectively modulate GPR4 activity for experimental purposes?

Selective modulation of GPR4 activity can be achieved through several approaches:

  • RNA interference (siRNA, shRNA) or CRISPR-Cas9 genome editing to manipulate GPR4 expression levels

  • Expression of dominant-negative GPR4 mutants (e.g., R123³·⁵⁰A) that compete with wildtype receptors

  • Selective GPR4 antagonists for pharmacological inhibition

  • Conditional expression systems (e.g., Tet-On/Off) to control GPR4 expression temporally

  • Biased ligands that selectively activate certain GPR4 signaling pathways over others

  • Engineered orthogonal receptor-ligand pairs for specific activation of recombinant GPR4

When designing these experiments, it's important to include appropriate controls for potential off-target effects and to validate target engagement using multiple independent approaches.

How does the orthosteric pocket of GPR4 compare with other class A GPCRs?

Structural analysis reveals distinct features of the GPR4 orthosteric pocket compared to other class A GPCRs:

  • Volume measurements using SiteMap program calculations show differences between GPR4 and both small molecule receptors (β2AR, A2AR) and peptidic receptors (NK1R, AGTR1)

  • GPR4 contains a cluster of aromatic residues within the orthosteric pocket that may propagate signaling to the intracellular region through conformational changes

  • The distribution of ionizable residues (histidines and acidic residues) in the extracellular domain creates a unique electrostatic environment for pH sensing

  • Unlike many class A GPCRs that bind discrete ligands, GPR4's orthosteric pocket appears specialized for detecting proton concentration changes

These differences provide opportunities for developing highly selective modulators of GPR4 function that don't cross-react with other GPCRs.

What can we learn from comparing GPR4 coupling mechanisms with well-characterized GPCRs?

Comparative analysis of GPR4 G protein coupling with well-characterized GPCRs reveals:

  • GPR4 exhibits a non-canonical G protein coupling model with more modest outward movement of TM5-TM6 (~4 Å) compared to canonical GPCR-Gs complexes (12-16 Å)

  • The GPR4-Gs structure resembles GPCR-Gi complexes more closely than typical GPCR-Gs complexes, suggesting a unique activation mechanism

  • The C-terminal tip of the α5 helix in the GPR4-Gs complex forms a similar hook structure to that in canonical Gs-coupled receptors, but moves 5-6 Å toward TMs 1 and 2 due to GPR4's smaller intracellular pocket

  • Other recently characterized GPCRs with non-canonical Gs-coupling models (GPR174, EP2, CCKAR) share features with GPR4, suggesting that large outward movement of intercellular TM5-TM6 is not a prerequisite for Gs protein recruitment

These observations expand our understanding of GPCR activation diversity and provide insights for engineering novel signaling properties into recombinant receptors.

How do evolutionary relationships among proton-sensing GPCRs inform functional predictions for GPR4?

Evolutionary analysis of proton-sensing GPCRs provides valuable functional insights:

  • Sequence alignment and structural prediction indicate conserved features among psGPCRs, including specific disulfide linkage patterns

  • Conservation of the triad of acidic residues crucial for proton sensing across psGPCRs suggests evolutionary preservation of this core sensing mechanism

  • Fungal homologs of GPR4 (e.g., GPR-4 in Neurospora crassa) function in carbon source sensing by coupling to GNA-1 in a cAMP signaling pathway, suggesting ancient origins of these signaling mechanisms

  • GPR4-related GPCRs are present in several filamentous ascomycete fungal pathogens, indicating potential roles in environmental sensing in these organisms

This evolutionary context provides a framework for predicting conserved versus divergent functions across species and can guide experimental design for heterologous expression studies.

What are common challenges in achieving functional expression of recombinant GPR4?

Researchers frequently encounter several challenges when expressing recombinant GPR4:

  • Low surface expression due to protein misfolding or retention in intracellular compartments

  • Constitutive activity that may mask pH-dependent responses

  • Receptor desensitization causing diminished signaling over time

  • Cell toxicity from overexpression of membrane proteins

  • Variability in expression levels between experiments affecting reproducibility

Troubleshooting approaches include:

  • Addition of chemical chaperones to improve folding

  • Use of inducible expression systems to control expression levels

  • Inclusion of pH-stabilizing compounds during cell culture

  • Careful validation of expression using flow cytometry or western blotting

  • Creation of stable cell lines rather than transient transfection for consistent expression

How can researchers address inconsistent results in pH-dependent activation assays?

Inconsistent results in pH-dependent activation assays often stem from several sources:

  • Insufficient pH buffering capacity leading to drift during experiments

  • Cell density variations affecting local acidification rates

  • Different passage numbers or culture conditions affecting receptor expression

  • Variations in CO2 levels affecting media pH during incubation

  • Batch-to-batch variability in transfection efficiency

Methodological solutions include:

  • Use of robust pH buffer systems with higher capacity than conventional media

  • Strict standardization of cell seeding density across experiments

  • Implementation of internal calibration standards for each experiment

  • Automated pH monitoring throughout experiments

  • Multiple technical and biological replicates with appropriate statistical analysis

What quality control measures should be implemented when working with purified recombinant GPR4?

Quality control for purified recombinant GPR4 should include:

  • Size exclusion chromatography to verify monodispersity and absence of aggregation

  • Circular dichroism spectroscopy to confirm secondary structure integrity

  • Thermal stability assays to assess protein folding and stability at experimental temperatures

  • Mass spectrometry to confirm protein identity and detect post-translational modifications

  • Ligand binding assays to verify functional integrity of the binding pocket

  • G protein coupling assays using purified G proteins to confirm signaling capability

Documentation should include batch records with expression conditions, purification protocols, yield data, and results of quality control tests to ensure reproducibility between protein preparations.

What are the most promising approaches for developing selective modulators of GPR4 function?

Developing selective GPR4 modulators represents an important frontier in research, with several promising approaches:

  • Structure-based drug design utilizing the recently determined cryo-EM structures

  • Fragment-based screening against purified recombinant GPR4

  • High-throughput functional assays measuring pH-dependent activation

  • Allosteric modulator discovery focusing on unique structural features of GPR4

  • Peptide-based inhibitors targeting the GPR4-G protein interface

  • Biased ligand development to selectively activate beneficial signaling pathways

The identification of the cluster of aromatic residues within the orthosteric pocket of GPR4 provides a potential target for small molecule development , while the unique non-canonical G protein coupling mechanism offers opportunities for developing selective G protein interface inhibitors.

How might single-cell analysis techniques advance our understanding of GPR4 biology?

Single-cell analysis techniques offer powerful approaches to address several key questions in GPR4 biology:

  • Single-cell RNA-seq to map GPR4 expression across tissues and correlate with disease states

  • Mass cytometry to simultaneously measure multiple signaling outputs downstream of GPR4 activation

  • Live-cell imaging with pH-sensitive and signaling reporters to track dynamics at the single-cell level

  • Single-molecule tracking to monitor GPR4 mobility and clustering in response to pH changes

  • Patch-clamp electrophysiology combined with pH manipulation to study effects on neuronal function

These approaches will help resolve heterogeneity in GPR4 responses across cell populations and elucidate how cellular context influences receptor function in ways that population-level measurements cannot capture.

What aspects of GPR4 biology remain poorly understood despite recent structural advances?

Despite recent structural breakthroughs, several aspects of GPR4 biology remain poorly understood:

  • The precise molecular mechanism by which protonation of key residues leads to conformational changes

  • Dynamic conformational changes during receptor activation that are not captured in static structures

  • The full complement of intracellular signaling partners beyond G proteins (e.g., arrestins, GRKs)

  • Potential for oligomerization with other GPCRs and how this affects signaling

  • Regulatory mechanisms controlling GPR4 expression in different tissues

  • The physiological significance of GPR4's apparent constitutive activity at neutral pH

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.