Recombinant Human G-protein coupled receptor 84 (GPR84)

Shipped with Ice Packs
In Stock

Description

Alternative Nomenclature and Classification

The receptor is also known by several alternative names, including:

  • EX33

  • G-protein coupled receptor 84

  • Inflammation-related G-protein coupled receptor EX33

These designations reflect both its structural classification and functional role in inflammatory processes.

Expression Systems and Production Methods

Recombinant human GPR84 is produced using various expression systems, with wheat germ being a common platform for commercial preparations . The choice of expression system significantly impacts the quality, yield, and functional properties of the recombinant protein.

Comparative Expression Efficiency in Mammalian Systems

Studies examining GPR84 orthologs from various species have shown that expression levels can vary significantly depending on the host cell system. For instance, when expressed in CHO-K1 cells, GPR84 from different mammalian species exhibited variable expression levels:

SpeciesRelative Total Expression (vs. Human GPR84)Cell Surface Expression (vs. Human GPR84)
OpossumLowerNot significantly different
Minke WhaleLowerNot significantly different
SheepLowerNot significantly different
RatHigher3-4 fold higher
CatHigherNot significantly different
PandaHigher3-4 fold higher
Polar BearNot significantly different3-4 fold higher
HorseHigherNot significantly different

This variation in expression efficiency must be considered when producing recombinant GPR84 for research or therapeutic applications .

Ligand Binding Properties and Receptor Activation

GPR84 responds endogenously to specific dietary fatty acids, particularly medium-chain free fatty acids (FFAs) with carbon chain lengths of C9 to C14. Among these, capric acid (C10:0), undecanoic acid (C11:0), and lauric acid (C12:0) have been identified as the most potent naturally occurring agonists .

Synthetic and Bacterial-Derived Ligands

In addition to endogenous fatty acids, several synthetic and bacterial-derived compounds have been identified as GPR84 ligands:

  1. Synthetic lipid-mimetic ligand LY237

  2. 3-hydroxy lauric acid (3-OH-C12), a putative endogenous ligand

  3. 6-(octylamino) pyrimidine-2,4(1H,3H)-dione (6-n-octylaminouracil, 6-OAU), a selective synthetic agonist

  4. Bacterial quorum sensing molecules including cis-2-decenoic acid and trans-2-decenoic acid

The discovery of bacterial communication molecules as GPR84 ligands suggests an evolutionary connection between this receptor and microbial detection mechanisms in the immune system .

Signaling Mechanisms and Downstream Effects

GPR84 primarily couples to the Gαi protein, resulting in inhibition of adenylyl cyclase and reduction of intracellular cAMP levels. In macrophages and neutrophils, GPR84 can additionally recruit Gα15 proteins, expanding its signaling repertoire .

Intracellular Signaling Cascades

Activation of GPR84 by appropriate ligands triggers several signaling pathways in immune cells:

  1. Phosphorylation of Akt

  2. Activation of extracellular signal-regulated kinase (ERK)

  3. Nuclear translocation of NF-κB p65

  4. In neutrophils, activation of the LYN-AKT/ERK pathway

These signaling events culminate in various cellular responses that contribute to the inflammatory function of GPR84.

Role in Immune Cell Function and Inflammation

GPR84 is predominantly expressed in immune cells, including monocytes, macrophages, neutrophils in the periphery, and microglia in the brain. Its expression is significantly upregulated under inflammatory conditions, suggesting a role in modulating immune responses .

Pro-inflammatory Functions

Activation of GPR84 in immune cells, particularly macrophages, leads to several pro-inflammatory effects:

  1. Enhanced expression of inflammatory cytokines and chemokines, including TNFα, IL-6, IL-12B, CCL2, CCL5, and CXCL1

  2. Increased bacterial adhesion and phagocytosis

  3. Stimulation of neutrophil chemotaxis, reactive oxygen species (ROS) production, and degranulation

  4. Regulation of NADPH oxidase activity through communication with formyl peptide receptors FPR1 and FPR2

  5. Enhancement of NLRP3 inflammasome activation

These functions collectively position GPR84 as an important amplifier of inflammatory responses once inflammation has been established .

Functional Variation Between Species

Comparative studies of GPR84 orthologs from diverse mammalian species have revealed significant variations in both sequence and function:

SpeciesBasal ActivityResponse to AgonistsNotable Features
Polar BearLower than humanVariableEvidence of positive selection
PandaLower than humanVariableEvidence of positive selection
Minke WhaleLower than humanVariableAdaptation to marine environment
OpossumLower than humanHigher EC50 than humanMarsupial-specific adaptations
African ElephantSimilar to humanHigher EC50 than humanUnique habitat adaptations

These variations likely reflect adaptations to different habitats, diets, and microbial challenges faced by each species .

Therapeutic Potential in Inflammatory and Metabolic Disorders

Given its role in inflammation and immune cell function, GPR84 has emerged as a potential therapeutic target for various inflammatory and metabolic disorders. These include:

  1. Ulcerative colitis

  2. Fibrotic diseases

  3. Nonalcoholic steatohepatitis

  4. Acute respiratory distress syndrome

Role in Wound Healing and Diabetes

Recent research has demonstrated that GPR84 plays a significant role in wound healing processes. GPR84 inhibition reduces myeloid cell numbers during the inflammation phase of skin wound healing, leading to defects in revascularization, re-epithelialization, and fibroblast repopulation .

Diabetic mouse models show impaired injury-stimulated adipocyte lipolysis, reduced wound-associated MCFAs, and reduced macrophage numbers, all of which are linked to GPR84 activity. Interestingly, administration of selective GPR84 agonists improved revascularization and wound closure in diabetic mice, suggesting potential therapeutic applications in diabetic wound healing .

Human Genetic Variation and Population Differences

Studies of human GPR84 genetic variants have identified loss-of-function mutations that occur with varying frequencies across different populations. These variants are most common in Asian populations, potentially influencing inflammation-related phenotypes in these groups .

Future Research Directions and Therapeutic Development

Research on recombinant human GPR84 continues to evolve, with several promising directions:

  1. Development of more selective GPR84 agonists and antagonists for therapeutic applications

  2. Further characterization of the structure-function relationship through additional cryo-EM studies

  3. Investigation of GPR84's role in specific inflammatory diseases

  4. Exploration of bacterial-derived GPR84 ligands as potential modulators of immune function

Molecules that antagonize the GPR84 receptor may become potential therapeutic tools in inflammatory and metabolic disorders, while agonists might have applications in situations requiring enhanced inflammation, such as diabetic wound healing .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that tag type.
Synonyms
GPR84; EX33; G-protein coupled receptor 84; Inflammation-related G-protein coupled receptor EX33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIA NLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTT ILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQE LDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTW LNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
Uniprot No.

Target Background

Function
GPR84 acts as a receptor for medium-chain free fatty acids (FFAs) with carbon chain lengths ranging from C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0), and lauric acid (C12:0) are the most potent agonists. It is not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acids is coupled to a pertussis toxin-sensitive G(i/o) protein pathway. GPR84 may play important roles in processes ranging from fatty acid metabolism to the regulation of the immune system.
Gene References Into Functions
  1. GPR84 modulates TNFalpha mRNA expression in LPS-tolerant monocytes. PMID: 28404994
  2. Our research demonstrates functional similarities but also important distinctions between GPR84 and FFA2R in human phagocytes, providing mechanistic insights into GPR84 regulation in blood neutrophils and cells recruited to an aseptic inflammatory site in vivo. PMID: 29477577
  3. Data suggest that cytokines TNFalpha and interleukin-1b significantly reduce GPR120/FFAR4 expression in adipocytes. Conversely, these cytokines induce expression of GPR84 and GPR41/FFAR3 in adipocytes. These studies were conducted in adipocytes cultured from subcutaneous adipose tissue. (GPR = G-protein coupled receptor; FFAR = free fatty acid receptor) PMID: 28835131
  4. Our findings indicate that diindolylmethane acts as a positive allosteric modulator for GPR84. PMID: 25425658
  5. We have identified a previously unrecognized role of GPR84 in maintaining fully developed acute myeloid leukemia by sustaining aberrant beta-catenin signaling in leukemic stem cells. PMID: 25293777
  6. The medium-chain fatty acid-sensing receptor, GPR84, is a proinflammatory receptor. PMID: 23449982

Show More

Hide All

Database Links

HGNC: 4535

OMIM: 606383

KEGG: hsa:53831

STRING: 9606.ENSP00000267015

UniGene: Hs.306199

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in hematopoietic tissues. High levels detected in the bone marrow and lower levels in the peripheral leukocytes and lung. Also expressed in brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta and intestine. Within

Q&A

What is GPR84 and what are its primary functions?

GPR84 is a G protein-coupled receptor that responds endogenously to dietary fatty acids or nutrients, specifically medium-chain free fatty acids (FFAs) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0), and lauric acid (C12:0) have been identified as the most potent natural agonists . In immune cells, GPR84 functions primarily as a pro-inflammatory receptor that promotes the expression of inflammatory mediators such as TNFalpha, IL-6, and IL-12B while stimulating chemotactic responses through activation of signaling mediators AKT, ERK, and NF-kappa-B . It also plays a significant role in inflammation by modulating neutrophil functions, promoting neutrophil chemotaxis, reactive oxygen species (ROS) production, and degranulation via the LYN-AKT/ERK pathway . Additionally, GPR84 has been characterized as a pro-phagocytic receptor that enhances phagocytic activities of macrophages .

What is the molecular structure of recombinant human GPR84?

Recombinant human GPR84 protein is typically available as a fragment protein spanning amino acids 208 to 316, expressed in wheat germ systems . The full protein has a molecular weight of approximately 43.7 kilodaltons . Recent structural studies have revealed a high-resolution structure of the GPR84-Gi signaling complex with the synthetic agonist 6-OAU, which shows an occluded binding pocket for the agonist . This structure elucidates the molecular basis of receptor activation involving non-conserved structural motifs of GPR84 and reveals an unusual Gi-coupling interface . The structure also suggests mechanisms for the high selectivity of GPR84 for medium-chain fatty acids and potential routes of ligand binding and dissociation .

What are the known agonists of GPR84?

GPR84 can be activated by several types of ligands:

Ligand TypeExamplesPotencyReference
Natural MCFAsCapric acid (C10:0)High
Undecanoic acid (C11:0)High
Lauric acid (C12:0)High
Modified MCFAs2-hydroxy MCFAsPotential ligands
3-hydroxy MCFAsPotential ligands
Synthetic agonists6-OAUHigh (surrogate agonist)

The synthetic agonist 6-OAU has been particularly useful in research settings as it provides a reliable means of activating GPR84 signaling pathways for experimental purposes .

How does GPR84 signaling influence inflammation and immune responses?

GPR84 signaling exerts pro-inflammatory effects through multiple mechanisms that operate in different immune cell types. In macrophages, GPR84 activation enhances NLRP3 inflammasome activation, which regulates the processing and release of pro-inflammatory cytokines . This activation also triggers increased bacterial adhesion and phagocytosis, suggesting a role in host defense against pathogens . In neutrophils, GPR84 promotes chemotaxis, ROS production, and degranulation via the LYN-AKT/ERK pathway, key processes in acute inflammatory responses .

For regulating ROS production, GPR84 communicates with formyl peptide receptors FPR2 and FPR1 to control NADPH oxidase activity in neutrophils . This cross-talk between different receptor systems represents an important regulatory mechanism in inflammatory responses. In vivo studies have demonstrated that administration of the GPR84 agonist 6-OAU to rats induces measurable increases in serum cytokine concentrations, confirming the pro-inflammatory function of GPR84 activation in living organisms .

What is the relationship between GPR84 and phagocytosis in cancer research?

Recent studies have revealed a promising role for GPR84 in cancer immunotherapy approaches. Activation of GPR84 by the synthetic agonist 6-OAU can synergize with the blockade of CD47 (a "don't eat me" signal) on cancer cells to induce phagocytosis of cancer cells by macrophages . This synergistic effect enhances the anti-tumor immune response by promoting the clearance of malignant cells.

The mechanism involves GPR84's function as a pro-phagocytic receptor, which, when activated, amplifies the phagocytic capacity of macrophages. When combined with strategies that neutralize inhibitory signals like CD47, this approach could potentially overcome tumor immune evasion mechanisms . This finding positions GPR84 as a potential target for developing novel combination immunotherapies that leverage innate immune responses against cancer.

How does the structural basis of GPR84 explain its selectivity for medium-chain fatty acids?

The high-resolution structure of the GPR84-Gi signaling complex has provided insights into the molecular basis for this receptor's selective recognition of medium-chain fatty acids compared to short- or long-chain fatty acids . Computational docking and simulation studies based on this structure suggest a mechanism for the high selectivity of GPR84 for MCFAs with carbon chain lengths of C9 to C14 .

The binding pocket for 6-OAU is occluded, indicating a specific structural arrangement that accommodates medium-chain molecules but excludes those with significantly shorter or longer carbon chains . The structure also reveals non-conserved structural motifs of GPR84 that are involved in receptor activation, differentiating it from other fatty acid receptors . Understanding these structural features provides a framework for developing highly selective ligands that can modulate GPR84 activity for therapeutic purposes.

What cellular models are optimal for studying GPR84 function?

Several cell models have proven effective for studying different aspects of GPR84 function:

Cell TypeApplicationAdvantagesReference
CHO-K1 with stable GPR84 expressionLigand screening, receptor characterizationWell-established, reproducible
HEK293-GPR84-EGFPInternalization assays, trafficking studiesVisualizable receptor movement
U937 (human leukemic monocyte lymphoma)Native GPR84 function, immune responsesEndogenous expression, relevant immune context
Human peripheral PMNsNeutrophil-specific functionsPrimary cells, physiological relevance
Sf9 insect cellsExpression of GPR84-Gαi1 fusion proteinHigh protein yield for binding assays

When selecting a cellular model, researchers should consider the specific aspects of GPR84 biology they wish to investigate. For basic receptor pharmacology and signaling, transfected cell lines like CHO-GPR84 or HEK293-GPR84 provide controlled expression systems. For immunological studies, myeloid cell lines or primary immune cells offer more physiologically relevant contexts where GPR84's pro-inflammatory and pro-phagocytic functions can be assessed .

What are the recommended protocols for assessing GPR84 activation and signaling?

Several established assays can be employed to measure GPR84 activation and downstream signaling:

  • GTPγS Binding Assay: This high-throughput screening approach measures the incorporation of [35S]GTPγS in membrane fractions expressing GPR84-Gαi1 fusion protein following agonist treatment. The assay requires incubation of the membrane fraction with [35S]GTPγS, cold 5 μM GDP, and test compounds at room temperature for 1 hour .

  • Phosphoinositide Accumulation Assay (PI Assay): This method requires transfection of HEK293 cells with GPR84 and pCEP-Gqi5-HA, followed by overnight labeling with myo-[3H]inositol. The accumulation of labeled inositol phosphates in response to agonist treatment (2 hours) is then measured .

  • Internalization Assay: Using HEK293-GPR84-EGFP cell lines, receptor internalization in response to agonists can be visualized by fluorescence microscopy. Cells are treated with different concentrations of agonist (e.g., 6-OAU) at 37°C for 30 minutes before imaging .

  • RNA Interference: For loss-of-function studies, GPR84 can be silenced using specific siRNA duplexes. The effectiveness of three different duplex sequences has been documented in the literature .

  • In Vivo Assessment: For examining GPR84 function in animal models, agonists like 6-OAU (1 mg/ml in PBS containing 1% rat serum) can be injected intravenously, followed by measurement of serum cytokine concentrations 3 hours post-injection using sandwich ELISA kits .

What are the technical considerations for working with recombinant GPR84 protein?

When working with recombinant human GPR84 protein (typically the fragment spanning amino acids 208 to 316), several technical considerations should be addressed:

  • Expression System: The wheat germ expression system has been successfully used to produce functional recombinant GPR84 protein suitable for ELISA and Western blot applications . This system provides appropriate post-translational modifications for mammalian proteins.

  • Storage and Stability: Reconstituted protein should be stored at -80°C in small aliquots to avoid repeated freeze-thaw cycles, which can compromise protein integrity and activity.

  • Functional Validation: Before experimental use, it is advisable to validate the functionality of the recombinant protein through ligand binding assays or functional assays like those described in section 3.2.

  • Antibody Selection: For detection and quantification purposes, researchers should carefully select antibodies with validated specificity for human GPR84. Multiple commercial antibodies are available, with applications spanning Western blot, ELISA, immunofluorescence, and flow cytometry .

  • Protein Fragment Considerations: Since commercially available recombinant GPR84 typically represents only a fragment of the full protein (aa 208-316), researchers should consider whether this fragment contains the domains relevant to their specific research questions.

How is GPR84 being investigated as a therapeutic target in inflammatory diseases?

Given its role as a pro-inflammatory receptor, GPR84 is being actively investigated as a potential therapeutic target for inflammatory conditions. Research has demonstrated that GPR84 activation promotes the expression of pro-inflammatory mediators such as TNFalpha, IL-6, and IL-12B . This suggests that GPR84 antagonists could potentially dampen inflammatory responses in diseases characterized by excessive inflammation.

The involvement of GPR84 in neutrophil functions, including chemotaxis, ROS production, and degranulation , makes it particularly relevant for acute inflammatory conditions where neutrophil activity contributes to tissue damage. Similarly, its role in enhancing NLRP3 inflammasome activation connects it to diseases where this pathway drives pathology.

Developing selective antagonists that can block GPR84 activation without affecting other fatty acid receptors represents a key area of ongoing research. The recently determined high-resolution structure of the GPR84-Gi signaling complex provides valuable information for structure-based drug design efforts targeting this receptor.

What is the relationship between GPR84 and immunometabolism?

The dual nature of GPR84 as both a metabolic sensor (responding to medium-chain fatty acids) and an immune modulator positions it at the intersection of immunometabolism—the emerging field that explores the relationship between metabolic processes and immune function.

Medium-chain fatty acids, the endogenous ligands for GPR84, can be derived from dietary sources or produced through lipolysis . The ability of GPR84 to sense these metabolites and subsequently modulate immune cell functions suggests it may serve as a nutrient-sensing receptor that links metabolic status to inflammatory responses. This connection is particularly relevant in conditions like obesity, where altered lipid profiles may influence GPR84 activation and contribute to chronic low-grade inflammation.

Research in this area is still evolving, with important questions remaining about how fluctuations in MCFA levels in different physiological and pathological states might influence GPR84 signaling and subsequent immune responses. The relatively low potency of endogenous MCFAs for GPR84 activation has led to questions about whether these lipids are indeed the exclusive physiological partners of this receptor .

How can computational approaches advance GPR84 research?

The availability of high-resolution structural data for the GPR84-Gi signaling complex opens new avenues for computational approaches in GPR84 research:

  • Structure-Based Drug Design: Computational docking and virtual screening can be employed to identify novel ligands with improved potency and selectivity for GPR84. This approach can accelerate the development of both agonists for research purposes and antagonists for potential therapeutic applications.

  • Molecular Dynamics Simulations: These simulations can provide insights into the conformational changes associated with receptor activation and the dynamics of ligand binding and dissociation. Such information is valuable for understanding the molecular mechanisms underlying GPR84 function.

  • Pathway Modeling: Computational modeling of GPR84 signaling networks can help predict the system-level consequences of receptor activation or inhibition in different cellular contexts. This approach is particularly relevant for understanding how GPR84 integrates with other inflammatory signaling pathways.

  • Structure-Function Relationships: Computational approaches can help identify key residues involved in ligand binding and receptor activation, guiding site-directed mutagenesis experiments to validate these predictions experimentally.

What are common challenges in GPR84 expression systems and how can they be addressed?

Researchers working with GPR84 expression systems may encounter several challenges:

ChallengePotential SolutionRationale
Low expression levelsOptimize codon usage for expression systemImproves translation efficiency
Use stronger promotersIncreases transcription
Optimize culture conditionsEnhances protein production
Protein misfoldingExpress in mammalian or insect cellsProvides appropriate folding machinery
Include molecular chaperonesAssists proper folding
Poor membrane localizationAdd trafficking signalsImproves transport to plasma membrane
Use C-terminal EGFP tagAllows monitoring of localization
Low activity in functional assaysEnsure proper G-protein couplingGPR84 primarily couples to Gi
Co-express with Gqi5 for PI assaysRedirects signaling to phospholipase C pathway

For successful functional studies, the GPR84-Gαi1 fusion protein expressed in Sf9 insect cells has proven effective for ligand screening in GTPγS binding assays . This approach ensures proper coupling between the receptor and its cognate G-protein, facilitating detection of activation-dependent signaling events.

How can specificity of GPR84 activation be confirmed in experimental settings?

Confirming that observed effects are specifically due to GPR84 activation is crucial for rigorous research. Several approaches can be employed:

  • RNA Interference: Silencing GPR84 expression using validated siRNA duplexes can help determine whether observed responses to putative GPR84 ligands are receptor-dependent. Three specific duplex sequences have been documented in the literature for effective GPR84 knockdown .

  • Pharmacological Controls: Using multiple structurally distinct agonists (e.g., natural MCFAs and synthetic compounds like 6-OAU) can help confirm that observed effects are due to GPR84 activation rather than off-target effects of a particular compound.

  • Dose-Response Relationships: Establishing dose-response curves for GPR84 agonists in various assay systems can help confirm that the observed potencies correlate with the compounds' known affinities for GPR84.

  • Comparison Across Cell Types: Demonstrating similar responses in multiple cell types expressing GPR84 (both endogenously and through recombinant expression) can strengthen the evidence for GPR84-specific effects.

  • Genetic Models: Where available, using cells or tissues from GPR84 knockout models can provide definitive evidence for receptor-specific effects.

What controls should be included in GPR84 signaling experiments?

Robust experimental design for GPR84 signaling studies should include several types of controls:

  • Positive Controls:

    • For agonist screening: Known potent agonists like 6-OAU at saturating concentrations

    • For functional assays: Compounds known to activate the pathway being measured independent of GPR84

  • Negative Controls:

    • Vehicle controls (solvent without active compound)

    • Structurally related compounds that don't activate GPR84

    • Short-chain or long-chain fatty acids that don't effectively activate GPR84

  • Specificity Controls:

    • Cells not expressing GPR84

    • Cells with GPR84 expression silenced by siRNA

    • Competitive antagonists (where available)

  • Technical Controls:

    • For radioligand binding assays: Non-specific binding (excess cold ligand)

    • For signaling assays: Positive controls for pathway activation (e.g., forskolin for cAMP pathways)

    • For immunodetection: Isotype controls and blocking peptides

What are the most significant recent advances in GPR84 research?

Recent years have seen several significant advances in our understanding of GPR84 biology:

  • The determination of the high-resolution structure of the GPR84-Gi signaling complex with 6-OAU has provided unprecedented insights into the molecular mechanisms of receptor activation and G-protein coupling .

  • The identification of GPR84 as a pro-phagocytic receptor that can synergize with CD47 blockade to enhance phagocytosis of cancer cells represents a promising new direction for cancer immunotherapy research .

  • The characterization of GPR84's role in neutrophil functions and its cross-talk with formyl peptide receptors has expanded our understanding of its contributions to inflammatory responses .

  • The development of potent synthetic agonists like 6-OAU has provided valuable tools for investigating GPR84 functions in various experimental systems .

These advances have collectively enriched our understanding of GPR84 as more than just a fatty acid sensor, positioning it as a multifunctional receptor with important roles in inflammation, immunity, and potentially, cancer.

What are the key unanswered questions in GPR84 biology?

Despite significant progress, several important questions about GPR84 biology remain unanswered:

  • Physiological Ligands: While MCFAs can activate GPR84, their relatively low potency has raised questions about whether these are indeed the exclusive physiological partners of this receptor . The identification of additional endogenous ligands remains an important research goal.

  • Tissue-Specific Functions: GPR84 expression has been detected in various tissues and cell types, but its functions outside of the immune system remain poorly characterized. Understanding its roles in different physiological contexts is an important area for future investigation.

  • Regulatory Mechanisms: The mechanisms controlling GPR84 expression, trafficking, and signaling in different cell types and under different conditions are not fully understood.

  • Pathological Relevance: While GPR84 has been implicated in inflammation, its specific contributions to inflammatory diseases, metabolic disorders, and cancer need further clarification.

  • Therapeutic Potential: The therapeutic potential of targeting GPR84 (either through activation or inhibition) in different disease contexts remains to be fully explored.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.