Recombinant Human Galanin receptor type 2 (GALR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag requirement, please inform us, and we will prioritize its development if possible.
Synonyms
GALR2; GALNR2; Galanin receptor type 2; GAL2-R; GALR-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTT NLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVS LDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWS APRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILI VAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFR KGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQ PCILEPCPGPSWQGPKAGDSILTVDVA
Uniprot No.

Target Background

Function
This receptor functions as a binding site for the hormones galanin and GALP. It also acts as a receptor for the hormone spexin-1. The receptor's activity is mediated by G proteins that activate the phospholipase C/protein kinase C pathway (via G(q)) and inhibit adenylyl cyclase (via G(i)).
Gene References Into Functions
  1. This study provides evidence that the GAL and GALR1/2 genes are aberrantly methylated in head and neck squamous cell carcinoma. PMID: 27685843
  2. GAL and its receptors, GALR1 and GALR2, play a significant role in the tumorigenesis of head and neck squamous cell carcinoma. PMID: 26572146
  3. The G protein-coupled receptor GALR2 promotes angiogenesis in head and neck cancer. PMID: 24568968
  4. In HEp-2 cells, GALR2-mediated apoptosis occurs in a caspase-independent manner. PMID: 24168112
  5. Activation of GalR2 leads to increased intracellular Ca(2+) levels due to Ca(2+) efflux from the endoplasmic reticulum through IP3R, sequentially opening BK alpha channels. PMID: 24602615
  6. The expression of GALR2 mRNA is lost in head and neck squamous cell carcinoma as a consequence of DNA methylation. Silencing of the GALR2 gene through methylation may be a crucial event in head and neck squamous cell carcinoma. PMID: 24122450
  7. Galanin receptor 2 promotes cell proliferation and survival, and contributes to tumor growth, suggesting an oncogenic role for GALR2 in squamous cell carcinoma of the head and neck. PMID: 21345369
  8. Elevated expression of galanin receptors is observed in childhood neuroblastic tumors. PMID: 11867941
  9. This study indicates that a high level of GalR2 galanin receptor expression can inhibit cell proliferation and induce apoptosis in neuroblastoma cells. PMID: 14592962
  10. There was no observed effect of GALR2 on alcoholism risk. PMID: 17083333
  11. These findings suggest that GalR2 could be a potential target for therapeutic interventions in pheochromocytoma. PMID: 18272487
Database Links

HGNC: 4133

OMIM: 603691

KEGG: hsa:8811

STRING: 9606.ENSP00000329684

UniGene: Hs.666366

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed abundantly within the central nervous system in both hypothalamus and hippocampus. In peripheral tissues, the strongest expression was observed in heart, kidney, liver, and small intestine.

Q&A

Which signaling pathways are activated by GALR2 stimulation?

GALR2 activates multiple signaling cascades with different physiological outcomes. The receptor primarily couples to the Gαq/11 class of G-proteins (PTX-insensitive pathway), triggering phospholipase C (PLC) activity and intracellular phosphoinositol turnover. This leads to Ca²⁺ release from intracellular stores and activation of Ca²⁺-dependent channels . Additionally, GALR2 can activate MAPK through protein kinase C (PKC) and Gαo-dependent mechanisms . In some contexts, GALR2 activation inhibits forskolin-stimulated cAMP production via PTX-sensitive Gαi/αo proteins, demonstrating the receptor's ability to modulate multiple downstream effectors .

What cell-based assays are most effective for measuring GALR2 activation?

The gold standard functional assay for GALR2 activation is measuring inositol phosphate (IP) accumulation in recombinant expression systems. For example, researchers can quantify IP1 production in HEK293 cells stably expressing GALR2 as a functional index of receptor activation . In published studies, galanin stimulates IP1 accumulation in HEK293-GALR2 cells with an EC₅₀ of 0.3 ± 0.6 μM . This assay provides a sensitive and reproducible method for screening potential GALR2 ligands and modulators.

How can researchers distinguish between GALR1 and GALR2 mediated effects in complex tissues?

Distinguishing between GALR1 and GALR2 effects requires a multi-faceted approach:

  • Use subtype-selective ligands: AR-M1896 (Gal(2-11)-NH₂) shows 500-fold selectivity for GALR2 over GALR1 receptors, making it an excellent pharmacological tool to isolate GALR2-specific effects .

  • Employ selective antagonists: M871 is a selective GALR2 inhibitor that can block GALR2-mediated responses without affecting GALR1 signaling .

  • Monitor distinct signaling pathways: GALR1 predominantly couples to Gi (cAMP inhibition), while GALR2 primarily signals through Gq (IP accumulation), allowing researchers to differentiate receptor activity based on second messenger responses .

  • Combine with genetic approaches: siRNA knockdown or CRISPR-Cas9 editing of specific receptor subtypes can complement pharmacological approaches for definitive subtype identification.

GALR2 Ligands and Modulators

CYM2503 represents a distinct pharmacological approach to GALR2 activation. Unlike direct agonists that bind to the orthosteric site, CYM2503:

  • Potentiates galanin-stimulated IP1 accumulation in HEK293-GALR2 cells

  • Shows no detectable affinity for the ¹²⁵I galanin-binding site

  • Functions as a positive allosteric modulator (PAM) by enhancing endogenous ligand activity

This mechanism offers potential advantages for therapeutic development, as PAMs may preserve the spatial and temporal aspects of endogenous galanin signaling while enhancing its effects.

What is the role of GALR2 in nociception and pain signaling?

GALR2 plays a complex role in pain processing that appears to differ based on dose, injury state, and anatomical context. In normal rats, intrathecal administration of low-dose galanin or the GALR2-selective agonist AR-M1896 induces mechanical and cold allodynia of the hindpaw, suggesting that GALR2 activation at low doses has a pronociceptive role at the spinal cord level . This contrasts with GALR1, which mediates antiallodynic effects on neuropathic pain when activated by high-dose galanin .

How does nerve injury alter GALR2 expression and function?

Peripheral nerve injury induces significant changes in GALR2 expression. In situ hybridization studies demonstrate that the number of GALR2 mRNA-positive neurons in rat dorsal root ganglia (DRG) decreases after axotomy . This receptor downregulation may explain why GALR2 agonists that normally induce excitatory effects in intact animals fail to elicit responses in nerve-injured models . The lesion-induced downregulation of GALR2 in DRG neurons shifts the balance toward a stronger influence of inhibitory postsynaptic GALR1 receptors in the dorsal horn, potentially explaining the enhanced inhibitory role of endogenous galanin after peripheral nerve injury .

What evidence supports GALR2's role in cardiac protection from ischemia/reperfusion injury?

Recent research demonstrates that GALR2 activation provides significant cardioprotection in experimental models. In a rat model of ischemia/reperfusion injury (40-minute left anterior descending coronary artery occlusion followed by 60-minute reperfusion), intravenous administration of either the GALR2-selective agonist WTLNSAGYLLGPβAH-OH (G1) or full-length rat galanin (G2) at an optimal dose of 1 mg/kg demonstrated remarkable protective effects :

  • Reduced infarct size by 35% (G1) and 32% (G2) compared to control

  • Decreased plasma activity of creatine kinase-MB by 43% (G1) and 38% (G2)

  • These protective effects were blocked by pre-administration of the selective GALR2 antagonist M871

These findings establish GALR2 as the principal receptor subtype mediating galanin's cardioprotective effects in myocardial ischemia/reperfusion injury.

What are the methodological considerations for studying GALR2 in cardiac models?

When designing experiments to investigate GALR2's role in cardiac protection, researchers should consider:

  • Timing of agonist administration: In published studies, optimal protection occurred when GALR2 agonists were administered at the fifth minute of reperfusion .

  • Dose-response relationships: Establish optimal dosing through careful titration (1 mg/kg was identified as optimal in rat models) .

  • Appropriate endpoints: Use multiple complementary measures such as infarct size (IS) and plasma biomarkers (CK-MB) to assess cardioprotection .

  • Pharmacological validation: Include appropriate antagonists (e.g., M871) to confirm receptor specificity of observed effects .

  • Species considerations: While rat models show clear GALR2-mediated protection, validation in other species may be necessary for translational research.

How does GALR2 modulation affect seizure activity in experimental models?

GALR2 represents a promising target for anticonvulsant therapy. The GALR2-positive allosteric modulator CYM2503 has demonstrated substantial anticonvulsant effects in multiple seizure models :

  • In the rat Li-pilocarpine status epilepticus model, intraperitoneal CYM2503:

    • Increased latency to first electrographic seizure

    • Increased latency to first stage 3 behavioral seizure

    • Decreased latency to the establishment of status epilepticus

    • Dramatically decreased mortality

  • In a Li-pilocarpine seizure model in mice, CYM2503:

    • Increased latency to first electrographic seizure

    • Decreased total time in seizure

  • CYM2503 also attenuated electroshock-induced seizures in mice

These findings establish GALR2 as a viable target for anticonvulsant drug development, with positive allosteric modulation offering a particularly promising approach.

What are the advantages of targeting GALR2 over other anticonvulsant strategies?

GALR2 represents a unique therapeutic target for several reasons:

  • Specificity: Unlike broad-spectrum ion channel modulators, GALR2-targeted compounds can modulate specific signaling pathways involved in seizure generation and propagation.

  • Allosteric modulation approach: Positive allosteric modulators like CYM2503 enhance endogenous galanin signaling without directly activating the receptor, potentially preserving physiological signaling patterns .

  • Different mechanism than current therapies: Many current anticonvulsants target ion channels or GABA signaling, making GALR2 modulators potentially useful for treatment-resistant epilepsies.

  • Scientific validation: Genetic studies support the target—downregulation of GALR2 expression in rat hippocampus significantly increased the severity of perforant path stimulation-induced status epilepticus .

What are the most appropriate expression systems for recombinant GALR2 studies?

For functional studies of recombinant GALR2, HEK293 cells have been established as a reliable expression system. These cells provide several advantages:

  • Low endogenous expression of relevant G-proteins and receptors

  • Robust expression of transfected GALR2

  • Appropriate cellular machinery for measuring downstream signaling events like IP1 accumulation

  • Well-characterized system allowing comparison between studies

When establishing stable GALR2-expressing cell lines, researchers should confirm receptor expression through both binding assays (using radiolabeled galanin) and functional assays (IP accumulation) to ensure the recombinant receptor maintains appropriate pharmacological properties.

How can binding affinity and functional activity be accurately measured for GALR2 ligands?

Comprehensive characterization of GALR2 ligands requires assessment of both binding affinity and functional activity:

For binding affinity:

  • Competitive binding assays using ¹²⁵I-labeled galanin as the radioligand

  • Results expressed as IC₅₀ values (the concentration of compound displacing 50% of specific binding)

For functional activity:

  • IP accumulation assays measuring Gq-coupled signaling

  • GTPγS binding assays for Gi/o-coupled signaling

  • cAMP inhibition assays as an alternative measure of Gi-coupling

Comparison of binding and functional data provides important insights. For example, AR-M1896 shows exceptional selectivity for GALR2 (IC₅₀ = 1.76 nM at GALR2 vs. 879 nM at GALR1), with robust functional activity (EC₅₀ = 9.32 nM in FLIPR assays) . This comprehensive assessment is critical for validating new research tools.

What are the challenges in developing small molecule modulators of GALR2?

Despite significant progress, several challenges remain in developing novel GALR2 modulators:

  • Complex pharmacology: GALR2 couples to multiple signaling pathways, making it difficult to develop compounds with desired signaling bias.

  • Limited structural information: Unlike some GPCRs, high-resolution structural data for GALR2 is lacking, hindering structure-based drug design.

  • Selectivity issues: Many compounds that target GALR2 also interact with other galanin receptors or unrelated targets. For example, early nonpeptide agonists Galnon and Galmic were found to interact with multiple targets in the CNS, raising concerns about potential side effects .

  • Species differences: The 15-amino acid C-terminal extension in human GALR2 versus rat GALR2 may affect drug binding and function across species .

Future development will likely focus on allosteric modulators like CYM2503, which may offer improved selectivity profiles compared to orthosteric ligands.

What are the most promising therapeutic applications for GALR2-targeted compounds?

Based on the current evidence, several therapeutic applications for GALR2 modulators show particular promise:

  • Anticonvulsant therapy: GALR2 positive allosteric modulators like CYM2503 have demonstrated robust anticonvulsant effects in multiple seizure models .

  • Cardioprotection: GALR2 agonists significantly reduce infarct size and biomarkers of cardiac damage in ischemia/reperfusion models, suggesting potential applications in myocardial infarction treatment .

  • Pain management: The complex role of GALR2 in pain processing suggests that selective antagonists might be beneficial in certain pain states, though this requires further validation .

Of these applications, anticonvulsant therapy currently has the strongest preclinical evidence base, with CYM2503 providing a promising starting point for further drug development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.