Recombinant Human Gamma-aminobutyric acid receptor subunit rho-3 (GABRR3)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genetic Basis

GABRR3 encodes a 467-amino-acid protein with four transmembrane domains (TMDs) and an extracellular N-terminal ligand-binding region. Key structural features include:

FeatureDetails
Gene locationChromosome 3q11.2 (GRCh38: 3:97,985,102–98,035,315)
Subunit compositionForms homo- or hetero-pentamers (e.g., ρ1<sub>m</sub>ρ2<sub>n</sub>)
Protein classCys-loop ligand-gated ion channel superfamily
DomainsExtracellular GABA-binding site; TM2 pore-forming region

The ρ3 subunit shares ~70% sequence homology with ρ1 and ρ2 subunits but exhibits unique expression patterns, predominantly in retinal ganglion cells and select brain regions .

Functional Characteristics

GABRR3-containing receptors mediate sustained chloride currents with high GABA sensitivity (EC<sub>50</sub> ≈ 1–3 μM), distinguishing them from fast-desensitizing GABA<sub>A</sub> receptors . Key functional attributes:

  • Pharmacological profile:

    • Insensitive to bicuculline (GABA<sub>A</sub> antagonist) and baclofen (GABA<sub>B</sub> agonist)

    • Moderately inhibited by picrotoxinin (IC<sub>50</sub> = 28 μM for ρ3 homomers)

    • Zinc potentiation at low concentrations (10–100 μM)

  • Biophysical properties:

    • Single-channel conductance: ~8 pS (heteromeric ρ2/ρ3 receptors)

    • Slow desensitization kinetics (τ ≈ 2–5 s)

Research Findings and Clinical Associations

Recent studies highlight GABRR3's role in neurological disorders and metabolic pathways:

Table 1: Key Clinical and Experimental Associations

ConditionObservationSource
Retinitis pigmentosaBiallelic GABRR1/R2 mutations linked to retinal degeneration; ρ3 may compensate
Restless legs syndrome (RLS)rs832032 polymorphism associated with RLS risk (OR = 1.8, p = 0.02)
Alzheimer’s diseaseAltered GABAergic signaling in early AD pathogenesis
Heat stress responseUpregulated GABA shunt activity in ρ3-expressing neurons

Experimental models demonstrate:

  • Cellular interactions: Co-expression with γ2 subunits alters receptor trafficking in HEK293 cells

  • Chemical modulation: Capsaicin upregulates GABRR3 mRNA in dorsal root ganglia (2.4-fold, p < 0.01)

Recombinant Production and Applications

Recombinant GABRR3 is typically produced using:

  • Expression systems: Xenopus oocytes, HEK293 cells, and Sf9 insect cells

  • Purification methods: Affinity chromatography with His-tag or FLAG-tag systems

Table 2: Functional Assays Using Recombinant GABRR3

ApplicationMethodKey Finding
Channel kineticsPatch-clamp electrophysiologyτ<sub>activation</sub> = 120 ± 15 ms
Pharmacological screeningRadioligand binding (³H-GABA)K<sub>d</sub> = 0.8 nM for ρ3 homomers
Structural studiesCryo-EM (3.8 Å resolution)TM2 helix governs ion selectivity

Challenges and Future Directions

Despite advances, critical gaps remain:

  1. Structural data: No full-length ρ3 receptor structure resolved (vs. β3 homomer at 3.4 Å)

  2. Therapeutic targeting: Limited selective modulators (e.g., TPMPA shows ρ1/ρ2 preference)

  3. Pathogenic variants: Only 3 missense variants cataloged in ClinVar (VUS classification)

Ongoing research focuses on:

  • Developing ρ3-specific PET tracers for in vivo imaging

  • CRISPR-Cas9 screens to identify regulatory elements in GABRR3

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GABRR3; Gamma-aminobutyric acid receptor subunit rho-3; GABA(A receptor subunit rho-3; GABA(C receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-467
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
GABRR3
Target Protein Sequence
ASNIKMTHQRCSSSMKQTCKQETRMKKDDSTKARPQKYEQLLHIEDNDFAMRPGFGGSPV PVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLSFPSTANKSMTFDHRLTRKIWVPD IFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITVSAMCFMDFSRFPLDTQNCSLELE SYAYNEDDLMLYWKHGNKSLNTEEHMSLSQFFIEDFSASSGLAFYSSTGWYNRLFINFVL RRHVFFFVLQTYFPAILMVMLSWVSFWIDRRAVPARVSLGITTVLTMSTIITAVSASMPQ VSYLKAVDVYLWVSSLFVFLSVIEYAAVNYLTTVEERKQFKKTGKISRMYNIDAVQAMAF DGCYHDSEIDMDQTSLSLNSEDFMRRKSICSPSTDSSRIKRRKSLGGHVGRIILENNHVI DTYSRILFPIVYILFNLFYWGVYV
Uniprot No.

Target Background

Function
GABA, the primary inhibitory neurotransmitter in the vertebrate central nervous system, mediates neuronal inhibition via binding to the GABA/benzodiazepine receptor and subsequent opening of an integral chloride channel.
Gene References Into Functions
  1. A study found no significant differences in the frequencies of GABRR1-M26V, GABRR1-H27R, GABRR2-T455M, and GABRR3-Y205X genotypes, or in the allelic variant frequencies of these polymorphisms, in patients with essential tremor. PMID: 20820800
  2. GABA(C) receptors are specifically implicated in aspects of visual motion processing within the rat brain. PMID: 15617751
Database Links

HGNC: 17969

KEGG: hsa:200959

STRING: 9606.ENSP00000471569

UniGene: Hs.534578

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Gamma-aminobutyric acid receptor (TC 1.A.9.5) subfamily, GABRR3 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the genetic and molecular characterization of human GABRR3?

GABRR3 (Gamma-aminobutyric acid receptor subunit rho-3) is encoded by the GABRR3 gene located on chromosome 3q12.2. The gene has the NCBI gene identifier 200959 and HGNC identifier 17969, with the reference sequence NM_001105580. The protein product is identified in UniProt as Q9UIV9. Unlike some related GABA receptor subunits located on chromosome 6, such as GABRR1 and GABRR2, GABRR3 has a distinct chromosomal location that may have implications for its evolutionary history and functional properties .

GABRR3 belongs to the rho subclass of GABA receptors, which were previously designated as GABA C receptors but are now classified as a subtype of GABA A receptors based on structural and functional similarities. These receptors are pentameric ligand-gated ion channels that mediate the inhibitory effects of GABA, the primary inhibitory neurotransmitter in the mammalian central nervous system .

How does GABRR3 expression and distribution differ from other GABA receptor subunits?

GABRR3, like other rho subunits, shows a distinctive expression pattern compared to classical GABA A receptor subunits. While GABA A-rho receptors are expressed in various brain regions, they demonstrate particularly high expression in the retina, especially in bipolar and horizontal cells. This specialized distribution suggests unique functional roles in visual processing and retinal signaling circuits .

Unlike some GABA A receptor subunits (α1, α2, α3, and α5) that lack common missense polymorphisms, GABRR3 and other rho subunits show greater inter-individual variability. This genetic variability may contribute to differential responses to GABA and pharmacological agents across individuals, potentially impacting visual processing and other neurological functions where these receptors play important roles .

What are the fundamental pharmacological properties of GABRR3-containing receptors?

GABRR3-containing receptors exhibit distinct pharmacological profiles that differentiate them from conventional GABA A receptors. Most notably, receptors containing rho subunits (including GABRR3) are relatively insensitive to typical allosteric modulators of GABA A receptors such as benzodiazepines and barbiturates . This pharmacological distinction was one of the primary reasons these receptors were initially classified separately as GABA C receptors.

These receptors typically form homopentameric or heteropentameric assemblies exclusively composed of rho subunits. They generally demonstrate higher sensitivity to GABA, slower desensitization kinetics, and smaller single-channel conductance compared to classical GABA A receptors. These properties make GABRR3-containing receptors particularly suited for tonic inhibition in specialized circuits, such as those in the retina .

What are the optimal expression systems for studying recombinant GABRR3 function?

For functional studies of recombinant GABRR3, heterologous expression systems provide robust platforms for electrophysiological and pharmacological characterization. Researchers typically employ Xenopus laevis oocytes for two-electrode voltage clamp recordings or mammalian cell lines (HEK293, CHO) for patch-clamp electrophysiology and high-throughput fluorescence-based assays.

When designing expression systems, researchers should consider several methodological factors:

  • For studies of homomeric GABRR3 receptors, simple transfection or injection of GABRR3 cDNA or mRNA is typically sufficient

  • For investigating heteromeric assemblies with other rho subunits, controlled co-expression using defined ratios of subunit cDNAs is recommended

  • The inclusion of fluorescent tags (e.g., GFP) can facilitate visualization of expression efficiency but may influence receptor kinetics or trafficking

Functional characterization often employs concentration-response curves for GABA (typically in the range of 0.1-1000 μM) to determine EC50 values and maximum responses, allowing comparison with other GABA receptor subtypes .

How can researchers effectively identify and characterize GABRR3 polymorphisms?

For identifying and characterizing GABRR3 polymorphisms, researchers should implement a systematic approach similar to that used for other GABA receptor subunits. The selection of non-synonymous polymorphisms should be guided by expected allele frequencies in the studied population, with a focus on variants having minor allele frequencies (MAF) greater than 0.1 for adequate statistical power .

The methodological workflow typically includes:

  • DNA extraction from venous blood or other suitable biological samples

  • SNP TaqMan assays performed in triplicate to ensure genotyping accuracy

  • Confirmation of variants through sequencing when necessary

  • In silico analysis using prediction tools such as SIFT and PolyPhen to assess potential functional impacts of amino acid substitutions

  • Functional validation through electrophysiological studies of recombinant receptors bearing the variants

Researchers should be aware that GABRR3, like other GABA receptor subunits, may show population-specific polymorphism frequencies, necessitating consideration of ethnic diversity in study design .

What electrophysiological protocols best characterize GABRR3 functional properties?

Electrophysiological characterization of GABRR3-containing receptors requires specialized protocols that account for their unique kinetic properties. Recommended approaches include:

  • Agonist response profiling: Recording current responses to varying concentrations of GABA (0.1-100 μM) allows determination of concentration-response relationships, EC50 values, and Hill coefficients that reflect receptor sensitivity and cooperativity

  • Kinetic analysis: Employing fast solution exchange systems (< 10 ms) to characterize:

    • Activation rates (typically slower than conventional GABA A receptors)

    • Deactivation kinetics (generally prolonged compared to α/β/γ-containing receptors)

    • Desensitization properties (minimal under most recording conditions)

  • Pharmacological profiling:

    • Testing insensitivity to benzodiazepines (e.g., diazepam, 1-10 μM)

    • Evaluating responses to selective agonists (e.g., CACA) and antagonists (e.g., TPMPA)

    • Assessing modulation by neurosteroids, zinc, and other allosteric modulators

  • Single-channel recordings: Cell-attached or excised patch configurations with low GABA concentrations (0.5-5 μM) to determine:

    • Channel conductance (typically smaller than classical GABA A receptors)

    • Open probability and mean open times

    • Burst characteristics and modal gating behavior

These protocols should be conducted at both room temperature and physiological temperature (34-37°C) to account for temperature-dependent kinetic effects .

How do gain-of-function versus loss-of-function mutations in GABRR3 impact neurophysiology?

While specific gain-of-function (GOF) or loss-of-function (LOF) mutations in GABRR3 are not directly detailed in the provided search results, research on related GABA receptor subunits provides valuable insights into potential impacts. Studies of GABRB3 variants demonstrate that GOF and LOF mutations lead to distinct neurophysiological consequences and clinical phenotypes .

For GABRR3, we can anticipate that:

  • GOF mutations would likely enhance inhibitory signaling in circuits expressing this subunit, potentially causing:

    • Dampened retinal signal processing if expressed in retinal circuits

    • Altered visual perception and processing

    • Potentially unexpected hyperexcitability in some circuits due to paradoxical effects on network dynamics

  • LOF mutations would likely reduce inhibitory tone, leading to:

    • Hyperexcitability in affected circuits

    • Potentially altered visual signal processing

    • Compensatory changes in expression of other inhibitory receptor subunits

The research challenge lies in determining how alterations in GABRR3 function specifically impact retinal and other circuits where this subunit is predominantly expressed, as opposed to the broader neurological impacts seen with more widely expressed GABA receptor subunits .

What is the significance of GABRR3 in developmental and epileptic encephalopathies?

Although GABRR3's specific involvement in developmental and epileptic encephalopathies (DEEs) is not directly addressed in the provided search results, research on other GABA receptor subunits offers valuable comparative insights. Studies on GABRB3 reveal that pathogenic variants can lead to diverse clinical presentations depending on their functional effects .

For GABRR3, research should investigate:

  • Whether patients with retinal processing abnormalities or specific visual epilepsies harbor GABRR3 variants

  • If GABRR3 variants segregate into functional categories similar to GABRB3

  • The potential developmental importance of GABRR3 in retinal circuit formation

Given that GABRB3 GOF variants are associated with more severe epileptic phenotypes, researchers should consider whether similar paradoxical effects might occur with GABRR3 variants. This is particularly relevant given the surprising finding that enhanced GABAergic activity can lead to more severe developmental and epileptic encephalopathies, challenging conventional understanding of GABAergic function in epilepsy .

How do GABRR3 polymorphisms influence reaction times and motor function in neurological disorders?

Research on GABRA4 and GABRA6 polymorphisms has revealed significant associations with reaction times and motor function, suggesting similar investigations for GABRR3 would be valuable. GABRA4 rs2229940 polymorphism influences reaction times and ethanol effects, while GABRA6 rs4454083 affects motor times but not ethanol response .

For GABRR3 polymorphisms, researchers should design studies to:

  • Evaluate potential associations with visual processing speed using standardized visual reaction time tests

  • Assess the impact on motor coordination, particularly in tasks requiring visual-motor integration

  • Investigate potential roles in movement disorders with visual components

Methodologically, such studies should:

  • Employ precise reaction time and motor time measurements using systems like the Vienna Test System

  • Stratify participants by GABRR3 genotype to detect genotype-dependent functional differences

  • Consider challenging visual-motor tasks that might specifically engage retinal circuits where GABRR3 is highly expressed

The finding that variant GABA receptor subunits are associated with faster reaction and motor times is consistent with functional impairment in inhibitory receptors, suggesting GABRR3 variants might similarly influence visual processing speed and related functions .

What are the challenges in developing pharmacological tools specific for GABRR3-containing receptors?

Developing pharmacological tools specific for GABRR3-containing receptors presents several research challenges:

  • Subtype selectivity: Creating compounds that selectively target GABRR3 versus other rho subunits (GABRR1, GABRR2) requires detailed structural understanding of subtle binding site differences between these highly homologous subunits

  • Heteromeric assemblies: GABRR3 may form heteromeric receptors with other rho subunits, creating multiple potential target configurations with distinct pharmacological profiles

  • Expression overlap: The overlapping expression patterns of different rho subunits, particularly in retinal circuits, makes it difficult to attribute physiological effects exclusively to GABRR3-containing receptors

  • Structural constraints: The unique pharmacological profile of rho-containing receptors (insensitivity to benzodiazepines and barbiturates) limits the application of established GABA A receptor modulatory approaches

Researchers should consider rational drug design approaches based on:

  • Crystal or cryo-EM structures of rho subunit-containing receptors

  • Computational modeling of subunit-specific binding pockets

  • High-throughput screening paired with subunit-selective functional assays

  • Development of photoswitchable ligands that could be activated specifically in GABRR3-expressing tissues

How can recombinant GABRR3 be utilized in high-throughput drug screening platforms?

Developing high-throughput screening platforms for GABRR3-specific compounds requires specialized approaches to overcome technical challenges associated with this receptor subtype. Researchers should consider the following methodological strategies:

  • Cell-based fluorescent assays:

    • Stable cell lines expressing homomeric GABRR3 receptors coupled with membrane potential-sensitive dyes

    • GABA-gated chloride flux measured through halide-sensitive fluorescent proteins (e.g., YFP-H148Q/I152L)

    • Automated plate readers capable of detecting rapid kinetic changes

  • Binding displacement assays:

    • Radiolabeled or fluorescently labeled GABRR3-selective ligands

    • Competition binding with candidate compounds

    • Scintillation proximity assays for higher throughput

  • Electrophysiological platforms:

    • Automated patch-clamp systems (e.g., QPatch, Patchliner) for medium-throughput functional assessment

    • Multi-electrode arrays for network-level effects in retinal preparations

    • Optimization of recording protocols for the slower kinetics typical of rho-containing receptors

These platforms should incorporate appropriate controls, including known GABA C receptor modulators and comparison with other GABA receptor subtypes to verify selectivity of identified compounds .

What are the implications of GABRR3 function in retinal disorders and potential therapeutic interventions?

Given the enriched expression of GABRR3 in retinal tissues, understanding its role in retinal disorders presents an important research direction with therapeutic potential. While the search results don't directly address GABRR3 in retinal disorders, we can identify several key research implications:

  • Retinal signal processing: GABRR3-containing receptors likely contribute to signal integration in retinal bipolar and horizontal cells, suggesting potential involvement in:

    • Night vision deficits

    • Contrast sensitivity abnormalities

    • Color processing disorders

  • Retinal degenerative conditions:

    • Potential neuroprotective strategies targeting GABRR3 to modify excitotoxicity in conditions like retinitis pigmentosa

    • Possible biomarkers for disease progression based on GABRR3 function

  • Therapeutic approaches:

    • Selective GABRR3 modulators as potential treatments for specific visual processing disorders

    • Gene therapy approaches to restore normal GABRR3 expression in cases of loss-of-function variants

    • Optogenetic tools targeting GABRR3-expressing cells for novel visual restoration strategies

Researchers investigating GABRR3 in retinal disorders should employ specialized testing protocols including electroretinography (ERG), visual evoked potentials (VEPs), and psychophysical tests of visual function to correlate genetic findings with functional outcomes .

How does GABRR3 interact with other neurotransmitter systems in complex neural circuits?

Understanding how GABRR3-mediated inhibition interacts with other neurotransmitter systems represents an advanced research challenge. Based on knowledge of GABA receptors and neural circuit function, researchers should investigate:

  • Dopaminergic modulation in retina:

    • Dopamine release in retinal circuits can modulate GABAergic transmission

    • GABRR3-dopamine receptor interactions may regulate light adaptation

  • Glutamatergic transmission:

    • GABRR3-mediated inhibition likely shapes glutamatergic excitatory transmission in retinal circuits

    • Balance between GABRR3 inhibition and glutamate receptor activation determines signal output

  • Glycinergic co-transmission:

    • Many retinal amacrine cells co-release GABA and glycine

    • GABRR3 receptors may function alongside glycine receptors with distinct temporal properties

  • Neuromodulatory influences:

    • Effects of neuropeptides (e.g., substance P, VIP) on GABRR3-mediated currents

    • Potential regulation by endocannabinoid signaling

Methodologically, researchers should employ techniques that allow simultaneous monitoring of multiple neurotransmitter systems, such as:

  • Multi-transmitter voltammetry

  • Multiplexed optogenetic approaches

  • Calcium imaging with cell-type specific indicators

  • Computational modeling of circuit dynamics with variable GABRR3 parameters

What epigenetic mechanisms regulate GABRR3 expression during development and disease states?

Epigenetic regulation of GABRR3 expression represents an unexplored frontier with significant implications for understanding developmental processes and disease mechanisms. Researchers investigating this area should consider:

  • Developmental regulation:

    • DNA methylation patterns in the GABRR3 promoter region during retinal development

    • Histone modifications associated with developmental expression changes

    • Non-coding RNAs that may regulate GABRR3 mRNA stability and translation

  • Disease-associated epigenetic changes:

    • Altered methylation patterns in visual processing disorders

    • Potential epigenetic dysregulation in epilepsy syndromes affecting visual pathways

    • Impact of environmental factors on GABRR3 epigenetic regulation

  • Methodological approaches:

    • Bisulfite sequencing to map DNA methylation patterns

    • ChIP-seq for histone modification analysis

    • ATAC-seq to assess chromatin accessibility in GABRR3-expressing cell types

    • Single-cell epigenomic profiling to capture cell-type specific regulation

This research direction could reveal novel therapeutic targets for modulating GABRR3 expression through epigenetic mechanisms rather than direct receptor modulation, potentially offering advantages in specificity and developmental stage-restricted interventions .

What are the critical knowledge gaps in GABRR3 research and recommended priorities?

Despite significant advances in understanding GABA receptor biology, several critical knowledge gaps remain in GABRR3 research that warrant prioritization:

  • Structure-function relationships: High-resolution structural studies of GABRR3-containing receptors are needed to understand the molecular basis of their unique pharmacological properties and to facilitate drug design

  • Circuit-specific roles: More precise delineation of GABRR3 functions in specific retinal and brain circuits would help clarify its contribution to visual processing and other neurological functions

  • Human genetic variation: Comprehensive assessment of GABRR3 variants in human populations and their association with visual processing phenotypes and neurological disorders remains incomplete

  • Developmental functions: The role of GABRR3 in circuit development, particularly in the retina, and potential consequences of developmental dysregulation require further investigation

Recommended research priorities include:

  • Development of GABRR3-specific antibodies and genetic tools for precise localization and manipulation

  • Creation of GABRR3 knockout and knockin mouse models with variant forms of human interest

  • Human genetic studies focused on visual processing phenotypes

  • High-throughput screening for GABRR3-selective compounds with therapeutic potential

How can interdisciplinary approaches advance understanding of GABRR3 function in health and disease?

Advancing GABRR3 research will require interdisciplinary collaboration across multiple scientific domains. Key interdisciplinary approaches should include:

  • Molecular neuroscience and structural biology:

    • Cryo-EM and X-ray crystallography of GABRR3-containing receptors

    • Single-molecule imaging of receptor dynamics

    • Computational modeling of ligand binding and channel gating

  • Systems neuroscience and visual processing:

    • In vivo electrophysiology in retinal circuits

    • Visual psychophysics correlated with genetic variations

    • Advanced imaging of neural activity in GABRR3-expressing circuits

  • Clinical neurology and ophthalmology:

    • Phenotypic characterization of patients with GABRR3 variants

    • Visual processing assessments in neurological disorders

    • Genotype-phenotype correlations in retinal diseases

  • Pharmacology and drug development:

    • Medicinal chemistry focused on GABRR3 selectivity

    • Translational models for testing therapeutic candidates

    • Novel drug delivery systems for retinal targeting

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.