Recombinant Human Gamma-secretase subunit APH-1A (APH1a)

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer containing 6% Trehalose.
Form
Available in liquid or lyophilized powder form.
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will fulfill your request.
Lead Time
Typically, we can ship products within 1-3 working days of receiving your order. Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 6xHis-SUMO-tagged
Synonyms
APH1A; PSF; CGI-78; UNQ579/PRO1141; Gamma-secretase subunit APH-1A; APH-1a; Aph-1alpha; Presenilin-stabilization factor
Datasheet & Coa
Please contact us to get it.
Expression Region
1-247aa
Mol. Weight
42.9kDa
Protein Length
Full Length of Isoform 2
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Homo sapiens(Human)
Target Names
Target Protein Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCKD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
APH1a is a non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that mediates the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). It is essential for the proper assembly of the gamma-secretase complex. This complex plays a crucial role in Notch and Wnt signaling pathways, regulating downstream processes through its involvement in processing key regulatory proteins and controlling cytosolic CTNNB1 levels.
Gene References Into Functions
  1. Studies demonstrate that purified PSEN1/Aph1A gamma-secretase and the APPC99-3XFLAG substrate exhibit progressive destabilization of consecutive enzyme-substrate complexes during sequential gamma-secretase processing of APP. This research provides a comprehensive model explaining how PSEN or APP mutations enhance amyloidogenic Abeta production, suggesting that environmental factors might contribute to Alzheimer's Disease risk. PMID: 28753424
  2. Data indicate that presenilin 1 (PS1)/anterior-pharynx-defective protein 1 (Aph1b), presenilin 2 (PS2)/Aph1aL, PS2/Aph1aS, and PS2/anterior pharynx defective 1 homolog B (Aph1b) gamma-secretase produced amyloid beta peptide (Abeta) with an elevated Abeta42+Abeta43-to-Abeta40 (Abeta42(43)/Abeta40) ratio compared to other gamma-secretases. PMID: 27608597
  3. Findings indicate that presenilin 1 (PS1)-containing gamma-secretase complexes were targeted to the plasma membrane, while presenilin 2 (PS2)-containing ones were localized to the trans-Golgi network and recycling endosomes. PMID: 27059953
  4. No statistically significant difference was observed in APOE or APH-1a polymorphisms, suggesting a weak association with the development of Alzheimer disease. PMID: 26738354
  5. A loss of PS/gamma-secretase function in cleaving Abeta42(43) might initiate Alzheimer's disease. PMID: 23291095
  6. Research demonstrates that extending the transmembrane domain of the amyloid precursor protein-derived C99 substrate in proximity to the cytosolic face significantly influences gamma-secretase cleavage specificity. PMID: 23253155
  7. The -980C/G polymorphism in the APH-1A promoter is linked to an increased risk of Alzheimer's disease. PMID: 21443683
  8. Coexpression of wild-type or S-palmitoylation-deficient APH1aL and nicastrin leads to significant stabilization of transgenic presenilin 1 in the brains of double-transgenic mice. PMID: 21123562
  9. Endogenous Aph-1a and its proteolytic fragment exhibit unique properties for cleavage control, which might have implications for gamma-secretase regulation and intracellular distribution. PMID: 20674680
  10. Co-overexpression of presenilin-1 or APH-1 abrogates gamma-secretase inhibition, possibly by preventing the incorporation of CRB2 into the gamma-secretase complex. PMID: 20299451
  11. Aph-1 directly interacts with full-length and C-terminal fragments of gamma-secretase substrates. PMID: 20145246
  12. APH-1 binds to presenilins and nicastrin, potentially playing a role in the maturation of presenilin-nicastrin complexes. PMID: 12471034
  13. Expression of APH-1A increases amyloid beta peptide levels and gamma-secretase activity. PMID: 12763021
  14. APH-1 and the gamma-secretase complex bind to the transmembrane domain region of nicastrin. PMID: 12917438
  15. Six distinct polymorphisms have been identified, but the polymorphisms in APH-1a/b coding regions are not linked to an increased risk of Alzheimer disease in an Italian population. PMID: 12972157
  16. APH-1 undergoes multiple endoproteolytic events, generating a stable C-terminal fragment that associates with nicastrin. PMID: 14593096
  17. Conserved transmembrane Gly122, Gly126, and Gly130 in the fourth transmembrane region of APH-1a are part of the membrane helix-helix interaction GXXXG motif and are crucial for the stable association of APH-1aL with presenilin, nicastrin, and PEN-2. PMID: 14627705
  18. Only the combined overexpression of presenilin 1 and nicastrin along with APH-1a G122D facilitated the formation of a fully active gamma-secretase complex. PMID: 15210705
  19. Both APH-1a splice forms and APH-1b are expressed in peripheral and neuronal cells. APH-1aS, APH-1aL, and APH-1b form separate, proteolytically active gamma-secretase complexes containing either one of the two presenilins. PMID: 15286082
  20. Knockdown of APH-1a, but not APH-1b, resulted in impaired maturation of nicastrin and reduced expression of presenilin 1, presenilin 2, and PEN-2 proteins. PMID: 15629423
  21. These findings collectively indicate that the three forms of APH-1 can substitute each other in presenilin (PS) complexes, and the transmembrane GxxxG region is essential for the stability of the APH-1 protein as well as the assembly of PS complexes. PMID: 16757808
  22. Over-expression of APH-1 and inhibition of proteasomal APH-1 degradation facilitated gamma-secretase cleavage of APP to generate Abeta. Consequently, degradation of the APH-1 protein is mediated by the ubiquitin-proteasome pathway. PMID: 17059559
  23. Analysis of a model of the gamma-secretase complex subunit architecture demonstrates the close proximity of the C-terminal fragment of presenilin with APH-1. PMID: 18801744
  24. Evidence suggests an association between the -980C/G polymorphism in the APH-1a promoter region and the development of sporadic Alzheimer's disease. PMID: 19368855
  25. The conserved transmembrane histidine residues contribute to APH1 function and can impact presenilin catalytic activity. PMID: 19369254

Show More

Hide All

Database Links

HGNC: 29509

OMIM: 607629

KEGG: hsa:51107

STRING: 9606.ENSP00000358105

UniGene: Hs.108408

Protein Families
APH-1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Expressed in leukocytes, lung, placenta, small intestine, liver, kidney, spleen thymus, skeletal muscle, heart and brain. Isoform 1 and isoform 2 are nearly expressed at the same level.

Q&A

What is the biochemical identity and function of APH-1A within the gamma-secretase complex?

APH-1A (Anterior Pharynx Defective 1A) is a non-catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins including Notch receptors and amyloid precursor protein (APP) . APH-1A is a seven-transmembrane-domain protein suspected to facilitate the association of nicastrin and presenilin in the gamma-secretase complex . It also interacts with substrates prior to their proteolytic processing, making it essential for normal gamma-secretase assembly .

Unlike other complex components, APH-1A plays a distinct structural role in stabilizing the complex rather than directly participating in proteolysis. Experimental evidence indicates that APH-1A deficiency reduces γ-secretase activity by approximately 70%, highlighting its crucial role in maintaining functional enzyme complexes .

How does APH-1A differ structurally and functionally from other APH1 isoforms?

Mammals express multiple APH1 isoforms, with distinct functional consequences. The three rodent Aph1 genes (Aph1A, Aph1B, Aph1C) were successfully targeted by homologous recombination in knockout studies, revealing their differential contributions to development and gamma-secretase activity .

Knockout studies demonstrate that:

GenotypePhenotypeEffect on γ-secretaseRegional Impact
Aph1A-/-Embryonic lethal (E10.5)~70% reduction in activityBroad developmental effects
Aph1BC-/-Viable into adulthoodModerate reductionBrain region-specific effects (strongest in brainstem and olfactory bulb)
Aph1A+/-ViableMinimal effectNot significantly altered

APH-1A-containing complexes have a central role in development, while APH-1BC-containing complexes show more regional specificity in the brain . This differential expression and function suggests that targeting APH-1BC-containing complexes might be less problematic for therapeutic interventions in Alzheimer's disease compared to APH-1A-containing complexes .

What methodologies are most effective for studying recombinant APH-1A in experimental settings?

When working with recombinant APH-1A protein, several methodological considerations are important:

  • Expression systems: Human embryonic kidney (HEK293) cells provide an effective system for expressing APH-1A for biochemical and functional studies .

  • Protein purification: Small volumes of APH-1A recombinant protein vials may occasionally become entrapped in the seal during shipment and storage, requiring careful handling .

  • Activity assays: For functional analysis, UAS-luciferase reporter gene assays with APP or Notch reporter constructs that include a Gal4-VP16 sequence in their cytoplasmic domains allow direct comparison of substrate processing .

  • Phosphorylation analysis: Label-free LC-MS/MS analysis on phosphopeptide-enriched trypsin digests can effectively identify phosphorylation sites on APH-1A .

  • Interaction studies: The PathHunter βarr2 recruitment assay provides a sensitive method to measure β-arrestin2 recruitment to APH-1A .

How do GRK kinases regulate APH-1A function through phosphorylation patterns?

GRK (G protein-coupled receptor kinase) enzymes generate distinct phosphorylation patterns on APH-1A that function as "barcodes" to differentially regulate γ-secretase activity and Aβ generation . Using biochemical assays, structural modeling, and molecular dynamics simulations, researchers have determined that GRKs 2, 3, 5, and 6 impart distinct APH-1A phosphorylation patterns within the second intracellular loop (ICL2) and C terminus .

Key phosphorylation sites and their experimental manipulation include:

Phosphorylation SiteLocationExperimental MutationsEffect on β-arrestin RecruitmentEffect on Aβ Generation
S103ICL2S103A (deficient)AlteredModulated
S105ICL2S105D (mimetic)EnhancedEnhanced
S110ICL2S110A/DDifferentially regulatedDifferentially regulated
S251C-terminusS251AReducedReduced
S257C-terminusS257AReducedReduced

Researchers have also generated double-phosphorylation mutants representing specific GRK knockout conditions:

  • S103A/S110A (representing GRK3/GRK5 knockout)

  • S105D/S110D (representing GRK2 knockout)

  • S251A/S257A (representing GRK2/GRK3/GRK5 knockout)

These phosphorylation patterns create conformationally distinct APH-1A-βarr2 complexes that differentially affect γ-secretase activity .

What is the molecular mechanism of β-arrestin2 interaction with APH-1A and how does it regulate gamma-secretase activity?

The interaction between β-arrestin2 (βarr2) and APH-1A represents a novel regulatory mechanism for γ-secretase activity. Molecular dynamics simulation studies reveal that the βarr2 finger loop region engages with ICL2 and ICL3 of APH-1A to facilitate this interaction . This conformation closely resembles a fully engaged GPCR-β-arrestin complex .

Methodologically, this interaction can be studied by:

  • Mutagenesis: Specific residues in the βarr2 finger loop region or ICL3 of APH-1A can be mutated to assess their effect on binding and Aβ generation .

  • Structural modeling: Molecular dynamics simulations provide insights into the conformational changes that occur during the interaction .

  • Functional assays: Effects on γ-secretase activity and Aβ generation can be measured to assess the functional consequences of the interaction .

Experimentally, treatment with CMPD101 (a GRK2/3 inhibitor) results in a significant increase in βarr2 recruitment to APH-1A, indicating that GRK-mediated phosphorylation regulates this interaction .

What experimental strategies can distinguish between the processing of different gamma-secretase substrates by APH-1A-containing complexes?

APH-1A-containing γ-secretase complexes process multiple substrates, including APP and Notch. Experimental approaches to distinguish between these processing events include:

  • Substrate-specific reporter assays: Using UAS-luciferase reporter gene assays with APP or Notch reporter constructs allows direct comparison of substrate processing . In Aph1A-deficient fibroblasts, both APP and Notch processing are affected to a similar extent (approximately 70% inhibition) .

  • Antibody-based detection: Different antibodies can detect specific cleavage products, though this makes direct comparison between substrates challenging .

  • Regional analysis: In Aph1BC-deficient mice, APP processing is affected differently across brain regions, with the strongest accumulation of APP-CTF observed in brainstem and olfactory bulb . This suggests regional specificity in substrate processing.

  • Genetic manipulation: Comparing the effects of different Aph1 knockout models (Aph1A-/- vs. Aph1BC-/-) reveals differential effects on substrate processing .

What are the implications of APH-1A polymorphisms in Alzheimer's disease risk, and how can they be studied?

Polymorphisms in the promoter region of APH-1A have been associated with an increased risk for developing sporadic Alzheimer's disease . Studying these polymorphisms requires several methodological approaches:

  • Genetic association studies: Comparing the frequency of specific polymorphisms between Alzheimer's disease patients and healthy controls.

  • Functional genomics: Assessing how these polymorphisms affect APH-1A expression and γ-secretase activity.

  • Animal models: Creating knock-in models with specific human polymorphisms to assess their effects on amyloid pathology.

  • Cell-based assays: Measuring the impact of polymorphisms on Aβ generation in cellular models.

The study of APH-1A polymorphisms is particularly relevant given the role of γ-secretase in APP processing and Aβ generation, which is central to Alzheimer's disease pathogenesis .

How can researchers effectively target APH-1A-containing gamma-secretase complexes for therapeutic development?

Developing therapeutics targeting APH-1A requires careful consideration of its essential developmental role. Key methodological approaches include:

  • Isoform-specific targeting: Given that Aph1BC-deficient mice survive into adulthood while Aph1A-deficient mice do not, targeting APH-1BC-containing complexes might be less problematic for Alzheimer's disease therapy .

  • Substrate-specific modulation: Developing compounds that selectively modulate the processing of specific substrates (e.g., APP over Notch) by APH-1A-containing complexes.

  • Phosphorylation-based approaches: Targeting specific phosphorylation patterns generated by GRK kinases to selectively modulate APH-1A function .

  • Interaction disruption: Developing compounds that specifically disrupt the interaction between βarr2 and APH-1A, which has been shown to regulate Aβ generation .

  • Regional targeting: Exploiting the regional differences in APH-1 isoform expression to develop brain region-specific therapeutics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.