Recombinant Human Ganglioside-induced differentiation-associated protein 1 (GDAP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments default to standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize its use in production.

Synonyms
GDAP1; Ganglioside-induced differentiation-associated protein 1; GDAP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
GDAP1
Target Protein Sequence
MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPR VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNIL ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Uniprot No.

Target Background

Function

Recombinant Human Ganglioside-induced differentiation-associated protein 1 (GDAP1) regulates the mitochondrial network by promoting mitochondrial fission.

Gene References Into Functions
  1. Characterization of GDAP1-associated Charcot-Marie-Tooth disease. PMID: 29694336
  2. Expansion of the GDAP1-related Charcot-Marie-Tooth (CMT) disease mutational spectrum, identifying new variants. The study highlights the predominance of axonal neuropathy in CMT associated with GDAP1, clinical characteristics, and variant frequency in the Chinese population. PMID: 29372391
  3. Demonstration of GDAP1's glutathione S-transferase (GST) enzyme activity in vitro, regulated by the hydrophobic domain 1 (HD1). HD1's amphipathic nature may induce organelle-mimicking liposome remodeling by GDAP1. PMID: 27841286
  4. Identification of GDAP1 variants in patients with inherited peripheral neuropathies (IPNs), including a founder mutation. This study describes the mutational spectrum and clinical features of GDAP1-related CMT in Japan. PMID: 28244113
  5. Report of an autosomal dominant CMT2K case with significant phenotypic variability due to a novel GDAP1 variant. PMID: 28236508
  6. GDAP1 hypomethylation as a potential biomarker for alcohol dependence severity and treatment outcome. PMID: 27128683
  7. Suggestion of GDAP1 as a primary gene for analysis in Italian CMT2 patients. PMID: 26525999
  8. Report on two CMT families with a novel Glu222Lys mutation in the GDAP1 gene, demonstrating both autosomal dominant and recessive inheritance. PMID: 25337607
  9. Observation of a relatively high frequency of SH3TC2 and GDAP1 mutations in demyelinating and axonal forms of CMT, respectively. PMID: 25429913
  10. Demonstration of a shared pathway and interdependence between JPH1 and GDAP1, suggesting JPH1's contribution to the phenotypic effects of GDAP1 mutations. PMID: 25168384
  11. GDAP1-associated polyneuropathy typically presents with a mild, slowly progressive phenotype. PMID: 23456260
  12. Suggestion that the pathophysiology of GDAP1-related CMT neuropathies involves abnormal mitochondrial distribution and movement along the cytoskeleton towards the endoplasmic reticulum and subplasmalemmal microdomains. PMID: 23542510
  13. GDAP1 regulates mitochondrial and peroxisomal fission through a similar mechanism. PMID: 23628762
  14. Identification of a novel heterozygous missense mutation (Arg120Gly) in GDAP1 in an Italian CMT2 family. PMID: 22971097
  15. Suggestion that GDAP1 mutations cause onion bulb-like formations of Schwann cells in peripheral neuropathies. PMID: 23147504
  16. Report of a French family with CMT due to simultaneous heterozygous MFN2 and GDAP1 mutations. PMID: 22546700
  17. Reduced GDAP1 levels, glutathione (GSH) concentration, and mitochondrial membrane potential in CMT4C patients. PMID: 21965300
  18. GDAP1 complements cell cycle delay at the G2/M phase in *Saccharomyces cerevisiae* fis1 gene-defective cells. PMID: 21890626
  19. Report on two RI-CMT patients with GDAP1 missense mutations. PMID: 21692914
  20. Observation that patients with dominant GDAP1 mutations can exhibit clear axonal CMT disease. PMID: 21753178
  21. Inability to predict the clinical outcome of GDAP1-related CMT solely based on genetic results (missense/nonsense mutations). PMID: 21365284
  22. Identification of a p.R120W mutation in GDAP1 causing autosomal dominant CMT with a variable clinical presentation. PMID: 21199105
  23. Review of mitochondrial dysfunction and the pathophysiology of CMT involving GDAP1 mutations. PMID: 20849849
  24. Observation of a 27% mutation frequency in the GST domain of GDAP1 in the dominant form of axonal CMT2K. PMID: 20685671
  25. Characterization of the CMT4C4 phenotype associated with a recurrent GDAP1 mutation common in European populations. PMID: 20232219
  26. Different cellular mechanisms affecting mitochondrial dynamics underlie similar clinical manifestations of GDAP1 mutations, depending on inheritance mode. PMID: 19782751
  27. Broad expression of GDAP1 in cancer cell lines of various tissue origins, with a consensus YY1 binding site in the GDAP1 core promoter. PMID: 19720140
  28. GDAP1 mutations as a frequent cause of autosomal recessive demyelinating CMT4A. PMID: 12499475
  29. Phenotypic variability associated with GDAP1 gene mutations in CMT, concerning associated signs and disease severity. PMID: 12868504
  30. Detection of six distinct mutant alleles in four families, four of which are novel. PMID: 14561495
  31. Identification of a homozygous thymidine deletion at nucleotide position 558, causing a frameshift at codon 186 and a stop codon at position 205. PMID: 15019704
  32. Potential role in maintaining the mitochondrial network. PMID: 15772096
  33. Report of a novel Met116Thr mutation in GDAP1 in a Polish family with axonal CMT4. PMID: 16343542
  34. GDAP1 mutation (M116R) in a CMT patient with pyramidal features. PMID: 16607474
  35. GDAP1's dimeric structure, similar to other cytosolic GSTs. Soluble protein preparation and glutathione-dependent activity assay against GST substrates are described. PMID: 16857173
  36. Identification of a novel R191X nonsense and a L239F missense mutation in GDAP1 causing CMT neuropathy. PMID: 17433678
  37. Detection of a novel C233T transversion at codon 78 (P78L) in six patients from three unrelated families. PMID: 18062449
  38. A novel GDAP1 Q218E mutation in autosomal dominant CMT disease. PMID: 18231710
  39. Identification of a novel Pro153Leu mutation in GDAP1 in a Polish family with CMT4C4. PMID: 18421898
  40. A novel GDAP1 mutation in an Old Order Amish family with autosomal recessive CMT disease. PMID: 18492089
  41. GDAP1 gene mutations as a common cause of early-onset autosomal recessive CMT. PMID: 18504680
  42. Clinical, electrophysiological, and genetic study of two patients with missense GDAP1 mutations and severe neuropathy. One mutation (Tyr279Cys) is novel. Despite similar mutations and electromyography findings, clinical courses differed. PMID: 18991200
  43. Suggestion that GDAP1's role extends beyond regulation of mitochondrial network dynamics to include energy production and mitochondrial volume control. PMID: 19089472
  44. This GDAP1 region contains critical overlapping motifs defining intracellular targeting by the tail anchor domain and functional aspects. PMID: 19340293
  45. Report of a novel missense mutation and two polymorphisms in the GDAP1 gene in a Turkish family with autosomal recessive CMT2. PMID: 19381883
  46. Recommendation to consider GDAP1 mutations in both recessive and sporadic cases of early-onset axonal CMT disease. PMID: 19500985
  47. Identification of thirty sequence variants in genes from CMT patients: five pathogenic mutations in GDAP1 and two in PRX. PMID: 19837996
Database Links

HGNC: 15968

OMIM: 214400

KEGG: hsa:54332

STRING: 9606.ENSP00000220822

UniGene: Hs.168950

Involvement In Disease
Charcot-Marie-Tooth disease 4A (CMT4A); Charcot-Marie-Tooth disease, axonal, with vocal cord paresis, autosomal recessive (CMT2RV); Charcot-Marie-Tooth disease 2K (CMT2K); Charcot-Marie-Tooth disease, recessive, intermediate type, A (CMTRIA)
Protein Families
GST superfamily
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Cytoplasm.
Tissue Specificity
Highly expressed in whole brain and spinal cord. Predominant expression in central tissues of the nervous system not only in neurons but also in Schwann cells.

Q&A

What is the domain structure of GDAP1 and how does it differ from canonical GST proteins?

GDAP1 contains a unique structural organization compared to canonical glutathione S-transferases. The protein consists of GST-like domains with several distinctive features:

  • N-terminal extension (NT)

  • Two GST-like domains (GSTL-N and GSTL-C)

  • A unique hydrophobic domain (HD1) with potential autoinhibitory function

  • GDAP1-specific insertion containing a distinctive α6 helix

  • C-terminal transmembrane domain (TM) that anchors to the outer mitochondrial membrane

These structural elements contribute to GDAP1's specialized function. Unlike canonical GSTs that function as detoxifying enzymes, GDAP1 plays a role in mitochondrial dynamics, particularly promoting mitochondrial fission. The α6 helix is especially unique, showing conformational flexibility with a hinge around residue 200, which may be critical for its physiological functions and interactions with other molecules, such as the cytoskeleton .

How does GDAP1 regulate mitochondrial dynamics?

GDAP1 acts as a regulator of mitochondrial network dynamics by promoting mitochondrial fission. Experimental evidence supports this role:

  • Overexpression of wild-type GDAP1 leads to mitochondrial fragmentation

  • Reduction of GDAP1 induces elongation of mitochondria resulting in a tubular architecture

  • The effect on mitochondrial morphology is distinct from oxidative stress-induced fragmentation

  • GDAP1's fission activity requires both the transmembrane domain and the unique hydrophobic domain

The protein appears to be a component of the physiological fission machinery, though it works through mechanisms different from other known fission proteins. GDAP1 activity must be tightly controlled, as mutations disrupting this control lead to peripheral nerve dysfunction. Its activity does not induce cytochrome c release, suggesting that GDAP1-mediated fission differs from apoptotic mitochondrial fragmentation .

What is the cellular and tissue distribution of GDAP1 expression?

GDAP1 shows a specific expression pattern within the nervous system:

  • Predominantly expressed in neurons rather than glial cells

  • High expression in motor and sensory neurons of the spinal cord

  • Expression in large neurons including cerebellar Purkinje neurons, hippocampal pyramidal neurons, mitral neurons of the olfactory bulb, and cortical pyramidal neurons

  • Minimal or absent expression in white matter and nerve roots

  • Satellite cells and Schwann cells are GDAP1-negative

This neuronal-specific expression pattern is important for understanding CMT disease mechanisms, as it suggests that despite the presence of both demyelinating and axonal phenotypes in GDAP1-linked CMT, the primary pathology likely originates in neurons. Expression levels increase during neural differentiation, suggesting developmental regulation .

What experimental approaches can be used to study GDAP1 subcellular localization?

Several complementary techniques can be employed to accurately determine GDAP1 subcellular localization:

  • Immunofluorescence microscopy with organelle markers:

    • Co-staining with mitochondrial markers (e.g., MitoTracker)

    • Counterstaining with markers for other organelles (ER, Golgi, peroxisomes)

  • Subcellular fractionation and western blot analysis:

    • Isolation of mitochondrial, cytosolic, and membrane fractions

    • Probing with anti-GDAP1 antibodies and organelle-specific markers as controls

  • Expression of tagged GDAP1 constructs:

    • GFP/FLAG-tagged full-length and deletion constructs

    • Analysis of localization patterns through confocal microscopy

  • Domain mapping experiments:

    • Systematic deletion of domains to identify localization signals

    • Point mutations in key residues to disrupt localization

These approaches have confirmed that GDAP1 localizes to mitochondria, with the C-terminal transmembrane domain being necessary and sufficient for correct mitochondrial targeting .

What are the major types of GDAP1 mutations associated with CMT disease, and how do they differ in pathogenic mechanisms?

GDAP1 mutations cause several forms of CMT disease through distinct mechanisms:

Mutation TypeInheritance PatternCMT SubtypePhenotype SeverityProposed Mechanism
Nonsense/FrameshiftAutosomal RecessiveCMT4ASevereLoss of function through protein truncation
MissenseAutosomal RecessiveCMT4ASevereLoss of function through protein stability/activity changes
MissenseAutosomal DominantCMT2KMild to ModeratePotential dominant-negative effects or haploinsufficiency

Missense mutations exhibit two main effects on mitochondrial morphology:

  • Most mutations (e.g., R120Q, R120W, R161H, R282C) induce mitochondrial fragmentation like wild-type GDAP1

  • Some mutations (e.g., T157P) cause mitochondrial aggregation

The molecular pathogenesis differs between recessive and dominant inheritance patterns. For recessive inheritance, loss of function is the likely mechanism. For dominant inheritance, mutations may exert dominant-negative effects, potentially by affecting mitochondrial fusion processes .

How do specific structural changes in GDAP1 missense mutations correlate with disease phenotypes?

GDAP1 missense mutations cluster in specific regions of the protein structure and affect stability and function in different ways:

Even conservative mutations (e.g., A247V) can destabilize these interaction networks, leading to disease. These structural insights explain how mutations scattered throughout the GDAP1 sequence can result in similar disease outcomes by affecting interconnected residue networks critical for protein stability and function .

What cellular and animal models are available for studying GDAP1 function and disease mechanisms?

Several experimental models have been developed to study GDAP1:

Cellular Models:

  • Overexpression systems in COS-7, HeLa, and neuroblastoma cell lines

  • GDAP1 knockdown in neuronal cell lines

  • Patient-derived fibroblasts

  • Human induced pluripotent stem cells (hiPSCs) differentiated into motor neurons from CMT patients and controls

Animal Models:

  • Mouse models with GDAP1 knockout or disease-associated mutations

  • Yeast models expressing human GDAP1 and variants

The hiPSC-derived motor neuron model is particularly valuable as it allows investigation of human neurons harboring patient mutations. These models have revealed that GDAP1 mutations impact cell proliferation and viability of neural cells, and are associated with cytosolic lipid droplets and perturbed mitochondrial morphology .

What in vitro techniques can be used to evaluate the functional consequences of GDAP1 mutations?

Several methodological approaches can assess the impact of GDAP1 mutations:

  • Protein stability assays:

    • Differential scanning fluorimetry to measure thermal stability

    • Limited proteolysis to assess conformational changes

    • Computational predictions (e.g., CUPSAT) validated by experimental data

  • Mitochondrial morphology analysis:

    • Fluorescence microscopy with mitochondrial staining

    • Classification of morphology patterns (tubular, fragmented, aggregated, etc.)

    • Quantification of mitochondrial length, number, and distribution

  • Mitochondrial function assessment:

    • Membrane potential measurements (e.g., JC-1 dye)

    • Respiration analysis using Seahorse technology

    • ATP production assays

    • Reactive oxygen species (ROS) detection

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of GDAP1 with potential partners

    • Proximity ligation assays to detect in situ interactions

    • Yeast two-hybrid screening to identify novel interactors

These approaches have revealed that GDAP1 mutations can affect protein stability, mitochondrial dynamics, and cellular redox balance, providing mechanistic insights into disease pathogenesis .

How does GDAP1 interact with other proteins involved in mitochondrial dynamics and what are the implications for therapeutic strategies?

GDAP1 functions within a complex network of proteins regulating mitochondrial dynamics:

  • GDAP1-induced mitochondrial fragmentation is blocked by dynamin-related protein 1 (DRP1) K38A coexpression

  • Mitofusins 1 and 2 can counterbalance GDAP1-mediated fragmentation

  • GDAP1 function may be integrated with other fission/fusion machinery components

This suggests potential therapeutic approaches:

  • Modulating the activity of counterbalancing proteins (e.g., enhancing mitofusin activity)

  • Developing small molecules that stabilize mutant GDAP1 proteins

  • Gene therapy approaches to restore GDAP1 levels in recessive cases

  • Targeting downstream pathways affected by GDAP1 dysfunction, such as mitochondrial oxidative stress

Understanding the precise mechanisms of GDAP1 interactions with other mitochondrial dynamics proteins is essential for developing targeted therapies for CMT4A and related disorders .

What is the relationship between GDAP1 dysfunction, mitochondrial oxidative stress, and axonal degeneration in CMT?

Recent research using hiPSC-derived motor neurons from CMT patients has begun to elucidate connections between GDAP1, oxidative stress, and neurodegeneration:

  • GDAP1 mutation may promote mitochondrial oxidative stress

  • Despite altered mitochondrial morphology, oxidative phosphorylation is not strongly affected in GDAP1 mutant cells

  • GDAP1-deficient motor neurons show accumulation of cytosolic lipid droplets

  • The metabolic changes and increased oxidative stress may lead to progressive axonal damage

These findings suggest a model where GDAP1 mutations lead to:

  • Altered mitochondrial dynamics

  • Increased ROS production

  • Metabolic disturbances and lipid accumulation

  • Progressive axonal dysfunction and degeneration

Targeting oxidative stress pathways may therefore represent a promising therapeutic approach for GDAP1-associated CMT. Further research is needed to determine the precise sequence of events from GDAP1 dysfunction to axonal degeneration, and the potential for intervention at different stages of this process .

How can structural biology approaches inform the development of stabilizers or functional modulators of mutant GDAP1?

Structural studies of GDAP1 and its disease-associated mutations provide opportunities for therapeutic development:

  • Crystal structures of wild-type and mutant GDAP1 reveal critical interaction networks

  • The hinge region in helix α6 around residue 200 represents a potential target for stabilizers

  • Hexadecanoic acid binding to a groove near the CMT mutation cluster suggests potential ligand binding sites

  • Different mutations affect protein stability to varying degrees, potentially requiring tailored approaches

Potential structure-based strategies include:

  • Rational design of small molecules that bind and stabilize the native conformation

  • Targeting the hydrophobic cluster centered around α7 to counteract mutation effects

  • Development of peptide mimetics that maintain critical helix-helix interactions

  • Computational screening of compound libraries against structural models of GDAP1 variants

These approaches could lead to personalized therapies based on specific mutation types and their structural consequences .

What non-mitochondrial functions of GDAP1 are being discovered and how might they contribute to disease pathogenesis?

Beyond its established role in mitochondrial dynamics, GDAP1 appears to have additional functions:

  • Potential involvement in calcium homeostasis

  • Interaction with the trans-Golgi network

  • Role in autophagy and maturation of lysosomes

  • Possible function in peroxisomal lipid metabolism

Recent studies using SH-SY5Y and HeLa models have suggested these additional roles, but their relevance to CMT pathogenesis remains to be fully established in neurons. The potential convergence of these functions may explain the complex phenotypes observed in patients with GDAP1 mutations.

Further research using patient-derived motor neurons is needed to understand how these non-mitochondrial functions contribute to the disease process and whether they represent additional therapeutic targets .

What experimental approaches can distinguish between loss-of-function and dominant-negative effects of GDAP1 mutations?

Determining whether specific GDAP1 mutations act through loss-of-function or dominant-negative mechanisms requires sophisticated experimental designs:

  • Co-expression studies:

    • Wild-type and mutant proteins co-expressed at varying ratios

    • Assessment of mitochondrial morphology and function

    • Measurement of wild-type protein activity in presence of mutant

  • Rescue experiments:

    • Introducing wild-type GDAP1 into cells with dominant mutations

    • Determining whether phenotype is reversed or persists

  • Biochemical interaction assays:

    • Pull-down experiments to detect aberrant protein interactions

    • Assessment of protein complex formation/disruption

  • In vivo studies with compound heterozygous models:

    • Creation of animals with both null and missense mutations

    • Comparison with heterozygous null and homozygous missense models

These approaches have suggested that while recessive mutations likely cause loss of function, dominant mutations like R120W may impair mitochondrial fusion processes even in the presence of wild-type protein, supporting a dominant-negative mechanism. Cell-based functional assays have proven reliable for testing the pathogenicity of unknown variants .

How do different cell types respond to GDAP1 deficiency, and what does this reveal about selective vulnerability in CMT?

Despite the widespread expression of GDAP1 in the nervous system, CMT primarily affects peripheral nerves. Understanding this selective vulnerability requires investigating differential cellular responses:

  • Motor and sensory neurons appear most vulnerable to GDAP1 dysfunction

  • Different cell types may have varying dependence on GDAP1-mediated mitochondrial dynamics

  • Compensatory mechanisms may exist in some neuronal populations but not others

  • The extreme length of peripheral axons may make them particularly dependent on proper mitochondrial distribution and function

Comparative studies analyzing the effects of GDAP1 mutations across different neuronal subtypes (motor, sensory, central) could provide insights into selective vulnerability. hiPSC-derived neuronal models offer an opportunity to explore these differences in human cells with patient-specific genetic backgrounds.

Understanding the basis of selective vulnerability could help develop targeted treatments that protect the most affected cell populations .

What are the key considerations for producing functionally active recombinant GDAP1 for structural and biochemical studies?

Producing high-quality recombinant GDAP1 presents several challenges:

ChallengeSolution
Poor solubility due to transmembrane domainDesign constructs lacking the C-terminal TM domain (GDAP1ΔTM)
Multiple domains affecting foldingSystematic testing of different domain combinations (e.g., GDAP1ΔHD1, GDAP1ΔNT)
Protein stability issuesOptimize buffer conditions; include stabilizing agents
Expression system selectionBacterial systems for core domains; mammalian/insect cells for full-length

For functional studies, careful consideration must be given to:

  • The impact of epitope tags on protein function

  • Whether deletion constructs retain relevant activities

  • Confirmation that purified protein maintains native fold

  • Validation through complementary in vitro and cellular assays

These approaches have allowed successful crystallization of GDAP1 core domains and biochemical characterization of binding properties, such as interactions with ethacrynic acid .

How can contradictory findings about GDAP1 function in different experimental systems be reconciled?

Research on GDAP1 has sometimes yielded apparently contradictory results due to:

  • Different model systems:

    • Overexpression vs. knockdown/knockout

    • Cell type-specific effects (neuronal vs. non-neuronal)

    • Species differences (human vs. mouse GDAP1)

  • Varied methodological approaches:

    • Acute vs. chronic alterations in GDAP1 levels

    • Dynamic vs. endpoint measurements

    • Different parameters measured

To reconcile contradictory findings:

  • Direct comparisons in the same experimental system

  • Careful control of expression levels

  • Focus on disease-relevant cell types (human neurons)

  • Integration of in vitro, cellular, and in vivo data

  • Distinguishing primary from secondary effects

Adopting standardized protocols and reporting comprehensive methodological details can help resolve discrepancies and build a more consistent understanding of GDAP1 function across experimental systems .

What high-throughput screening approaches show promise for identifying GDAP1 modulators with therapeutic potential?

Several screening platforms could accelerate the discovery of compounds that modulate GDAP1 function:

  • Structure-based virtual screening:

    • Computational docking against crystal structures

    • Molecular dynamics simulations to identify cryptic binding sites

    • Fragment-based approaches targeting key interaction networks

  • Cell-based phenotypic screens:

    • Mitochondrial morphology readouts in patient cells

    • Automated imaging and analysis of mitochondrial dynamics

    • CRISPR-based screens for genetic modifiers

  • Thermal shift assays:

    • Differential scanning fluorimetry with compound libraries

    • Identification of stabilizers of mutant GDAP1 proteins

    • Monitoring protein-protein interactions

  • Biochemical activity assays:

    • Development of robust assays measuring GDAP1 function

    • Adaptation to high-throughput format

    • Counter-screens to ensure specificity

Integration of these approaches could identify compounds that specifically target disease-relevant aspects of GDAP1 function, such as stabilizing mutant proteins or modulating mitochondrial dynamics in a beneficial direction .

How might gene therapy approaches be optimized for treating different forms of GDAP1-associated CMT?

Gene therapy strategies must be tailored to different inheritance patterns and mutation types:

For recessive CMT4A (loss-of-function):

  • AAV-mediated gene replacement with wild-type GDAP1

  • CRISPR-based correction of specific mutations

  • Optimization of neuronal-specific promoters

  • Careful dosing to prevent overexpression effects

For dominant CMT2K (dominant-negative):

  • Allele-specific silencing of mutant GDAP1

  • Antisense oligonucleotides targeting mutant transcripts

  • Combined approach with wild-type supplementation

  • CRISPR-based inactivation of mutant allele

Delivery challenges:

  • Targeting peripheral neurons with sufficient efficiency

  • Crossing the blood-nerve barrier

  • Achieving long-term expression

  • Determining optimal intervention timing

Recent advances in AAV engineering and CRISPR technology make these approaches increasingly feasible, though they will require careful optimization for the specific subtypes of GDAP1-associated CMT .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.