Recombinant Human Gap junction alpha-5 protein (GJA5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order. We will prepare the protein according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJA5; Gap junction alpha-5 protein; Connexin-40; Cx40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-358
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
GJA5
Target Protein Sequence
GDWSFLGNFLEEVHKHSTVVGKVWLTVLFIFRMLVLGTAAESSWGDEQADFRCDTIQPGC QNVCYDQAFPISHIRYWVLQIIFVSTPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSG SYEYPVAEKAELSCWEEGNGRIALQGTLLNTYVCSILIRTTMEVGFIVGQYFIYGIFLTT LHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAALSLLLSLAELYHLGWKKIRQRFVKP RQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQV RGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
Uniprot No.

Target Background

Function
A gap junction is composed of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low molecular weight materials diffuse from one cell to an adjacent cell.
Gene References Into Functions
  1. Atrial Fibrillation (AF)-linked Cx40 mutants impair gap junction and/or hemichannel function, which may increase the susceptibility of mutant carriers to AF. PMID: 29587382
  2. The GJA5 gene rs35594137 polymorphism is significantly associated with sudden cardiac death in the studied group. PMID: 28577096
  3. A missense polymorphism in GJA5 is independently associated with an increased risk for Complete heart block after surgical repair of Congenital Heart Disease. PMID: 27826129
  4. Cx40 genetic polymorphisms increase atrial fibrillation risk in Uyghur and Han residents of Xinjiang. PMID: 27813566
  5. Cx 40 (rs35594137) was associated with atrial fibrillation. In the Uygur population, Cx 40 (rs35594137) should be considered an independent risk factor for patients with atrial fibrillation, who might have racial differences in rs35594137 variant frequencies PMID: 26634538
  6. This review summarizes atrial fibrillation-linked somatic and germline mutations in the gene encoding Cx40. Multiple impairments were observed in these mutants, including impaired gap junction function due to abnormal localization or function, as well as increased hemichannel function. PMID: 24656738
  7. Human atrial myocytes express Cx40 and Cx43. However, in vitro expression studies indicate that human Cx40 is unable to dock with Cx43 to form heterotypic gap junction channels. This study designed two Cx40 variants, D55N or P193Q. Both were successful in forming functional heterotypic gap junction channels with Cx43. PMID: 26625713
  8. Two polymorphisms in the Cx40 promoter are associated with hypertension and left ventricular hypertrophy, predominantly in men. PMID: 25992486
  9. The study reports an interaction between ALK1 signaling and connexin40 in the development of arteriovenous malformations. PMID: 26821948
  10. Reduced Cx40 levels and heterogeneity in its distribution (compared to Cx43) are common in atrial fibrillation. PMID: 25200600
  11. Two atrial fibrillation-linked germline Cx40 mutants, V85I and L221I, were investigated. PMID: 24733048
  12. Degradation of a connexin40 mutant linked to atrial fibrillation is accelerated. PMID: 24973497
  13. These findings provide evidence that the connexin 40 Q49X mutant is capable of impairing gap-junction distribution and function of key atrial connexins, which might play a role in the predisposition to and onset of atrial fibrillation. PMID: 24626989
  14. Heterozygous Cx40A96S mice exhibit prolonged episodes of induced atrial fibrillation and severely reduced atrial conduction velocities similar to the corresponding human patient. PMID: 24060583
  15. 4 novel heterozygous GJA5 mutations, p.K107R, p.L223M, p.Q236H and p.I257L, were identified in 4 of 310 unrelated AF patients. PMID: 23292621
  16. The germline familial mutations in Cx40 impair the gap junctions through various mechanisms, which may predispose the mutant carriers to AF. PMID: 23348765
  17. Presence of the Cx40 minor allele (-44 G --> A) results in a uniform down-regulation of right atrial appendage Cx40 protein which was not significantly related to the development of post-operative AF. PMID: 22423256
  18. Pro265Ser variant in the carboxyl-terminus of connexin 40 alters GAP junctions and increases risk for tetralogy of Fallot. PMID: 22713807
  19. Genotyping of rs10465885 showed that patients with early-onset lone AF were more likely to carry the A allele compared with controls (odds ratio = 1.30; P = 0.011). PMID: 23040431
  20. Cx40 coding SNPs are uncommon in atrial fibrillation populations, although rare mutations in this gene may lead to atrial fibrillation pathogenesis. PMID: 23134779
  21. Results implicate GJA5 as the gene responsible for the congenital heart disease phenotypes observed with copy number imbalances at this locus. PMID: 22199024
  22. Our study could not detect an association of Cx40 promoter polymorphisms and CAD in humans. PMID: 22405441
  23. This is the first evidence of intrinsic differences in the Ca2+ regulatory properties of Cx43 and Cx40. PMID: 22422398
  24. Heteromeric cotransfection of Cx40-WT and Cx40-Q58L resulted in homogenous distribution of proteins in the plasma membrane rather than in membrane plaques in approximately 50% of cells; well-defined gap junctions were observed in other cells. PMID: 22247482
  25. Regulation of endothelial connexin40 expression by shear stress via PI3K/Akt pathway. PMID: 22021330
  26. Association between hereditary sick sinus node syndrome and connexin 40 gene polymorphism was demonstrated. PMID: 21649591
  27. There is an alternate promoter polymorphism that directly affects levels of Cx40 mRNA in vivo and is associated with early-onset lone atrial fibrillation. PMID: 21076161
  28. Three novel connexin40 mutations (p.V85I, p.L221I, and p.L229M) were identified which co-segregated with atrial fibrillation and were absent in the controls without atrial fibrillation. PMID: 20650941
  29. In patients with cerebral ischemic events, without prior CVD, a higher prevalence of the Cx40 gene polymorphism, as a marker of underlying idiopathic atrial fibrillation appeared to be absent. PMID: 19494781
  30. Data suggest that these dynamic changes of connexins 43, 40 and 45 during mouse cardiac development appear to be mirrored in humans. PMID: 12064615
  31. Our data show that the presence of Cx40 does not allow GJIC and is associated with the extravillous phenotype. PMID: 12397213
  32. Endothelial gap junction protein connexin 37 and connexin 40-mediated communication in the development and/or functional maintenance of segments of the mouse vasculature. PMID: 12435353
  33. 505 CHD cases were screened for the Cx40 gene to see if altered copy number associated with a cardiac phenotype. 3 cases carried deletions on chromosome 1q21.1 spanning ACPL1, Cx40, and Cx50 genes, with aortic arch anomalies being a particular feature. PMID: 15117819
  34. The -44A allele & -44AA genotype were significantly more frequent in subjects with prior AF than in those without, providing strong evidence linking Cx40 polymorphisms to enhanced atrial vulnerability and increased risk of AF. PMID: 15297374
  35. Coinheritance of Cx40 polymorphisms is a possible genetic factor that modifies the clinical manifestation of this inherited arrhythmia. PMID: 16188595
  36. We conclude that decidual secretion of growth factors, such as EGF, may act to prime trophoblast for migration/invasion through modulation of connexin expression and function. PMID: 16545451
  37. There may be more than one conformational form of the connexin40 carboxyl tail with roles in atrial conduction and arrhythmogenesis. PMID: 16600287
  38. Cx40 polymorphisms are associated with enhanced spatial dispersion of refractoriness and thus with susceptibility to reentry and atrial fibrillation. PMID: 16646598
  39. Four novel heterozygous missense mutations were identified in 4 of the 15 patients. Mutations in GJA5 may predispose patients to idiopathic atrial fibrillation by impairing gap-junction assembly or electrical coupling. PMID: 16790700
  40. The two SNPs in the promoter region of the Cx40 gene were significantly associated with atrial fibrillation, and the Cx40 (-44A +71G) haplotype was associated with a higher risk for atrial fibrillation. PMID: 16814413
  41. A cross-talk between CFTR and a variety of gap junction channels has been observed. Cytoskeletal scaffolding proteins and/or other intermediate cytoplasmic proteins are likely involved in CFTR-connexins interaction. PMID: 17546509

Show More

Hide All

Database Links

HGNC: 4279

OMIM: 108770

KEGG: hsa:2702

STRING: 9606.ENSP00000271348

UniGene: Hs.447968

Involvement In Disease
Atrial standstill 1 (ATRST1); Atrial fibrillation, familial, 11 (ATFB11)
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is GJA5 and what are its key functions in human physiology?

The gap junction alpha-5 protein (GJA5), also known as connexin-40 (Cx40), is encoded by the GJA5 gene in humans. GJA5 is a member of the connexin gene family and functions as a component of gap junctions, which are intercellular channels that provide pathways for the diffusion of low molecular weight molecules between adjacent cells .

GJA5 plays a critical role in the electrical coupling between cardiac cells. Mutations in this gene have been associated with atrial fibrillation and congenital heart disease, particularly at chromosome 1q21.1 . Research has also indicated GJA5 involvement in pulmonary conditions, including the development of edema and inflammation during certain lung injuries .

What experimental techniques can be used to study recombinant GJA5 protein?

Multiple experimental approaches can be employed to study recombinant GJA5:

TechniqueApplicationExpected Outcomes
SDS-PAGEProtein purity assessmentVisualization of protein at ~40 kDa band
Western BlottingExpression detection and quantificationSpecific immunoreactive bands corresponding to GJA5
ELISAQuantitative measurementStandard curves for protein quantification
ImmunofluorescenceLocalization studiesVisualization of membrane localization and gap junction plaques
Functional studiesGap junction communicationDye transfer between cells expressing GJA5
Promoter-luciferase assaysTranscriptional regulationQuantification of promoter activity (e.g., wild-type vs. variant)

How should researchers design experiments to investigate GJA5 variants in cardiovascular disease?

When studying GJA5 variants in cardiovascular disease, a comprehensive experimental design should include:

  • Cohort Selection: Carefully select case and control groups with clear inclusion/exclusion criteria. For example, in studies of essential hypertension, cases should meet diagnostic criteria (systolic BP ≥140 mmHg, diastolic BP ≥90 mmHg) while excluding secondary hypertension and other confounding conditions .

  • Genotyping Strategy:

    • Extract genomic DNA from blood leucocytes using standardized purification kits

    • Verify DNA quality via agarose gel electrophoresis and spectrophotometry

    • Design specific primers for amplifying regions of interest

    • Implement appropriate sequencing methods to identify variants like rs10465885

  • Functional Characterization:

    • Construct recombinant reporter plasmids containing wild-type and variant sequences

    • Transfect relevant cell lines and measure promoter activity

    • Quantify expression differences using luciferase reporter assays

    • Previous studies have shown that the -26A>G variant significantly reduces promoter activity (165.67±16.85 vs 61.53±8.67, P=0.0007)

  • Correlation Analysis:

    • Measure relevant biomarkers (e.g., plasma renin levels)

    • Compare biochemical parameters between genotype groups

    • Perform statistical analysis to establish significant associations

What are the optimal expression systems for producing functional recombinant human GJA5?

Various expression systems can be used to produce recombinant human GJA5, each with distinct advantages:

Expression SystemAdvantagesConsiderationsApplications
HEK-293 Cells- Proper post-translational modifications
- Correct membrane insertion
- >90% purity achievable
- Lower yield than bacterial systems
- Higher cost
Functional studies requiring native protein conformation
Cell-free protein synthesis (CFPS)- Production of difficult-to-express proteins
- Maintains machinery for modifications
- 70-80% purity achievable
- May require additional purification stepsRapid production for screening studies
E. coli- High yield
- Cost-effective
- >95% purity possible
- Lacks post-translational modifications
- May require refolding
Structural studies, antibody production

The choice of expression system should be guided by the specific experimental requirements. For functional studies investigating channel activity, mammalian systems are preferred, while bacterial systems may be sufficient for antibody production or structural analysis .

How can researchers effectively validate genetic associations between GJA5 variants and disease?

Validating genetic associations between GJA5 variants and disease requires a multi-faceted approach:

  • Population Studies:

    • Design case-control studies with adequate sample sizes (e.g., 380 patients with essential hypertension and 396 matched controls)

    • Match participants for age, sex, and ethnicity to minimize confounding factors

    • Define clear phenotypic criteria (e.g., standardized blood pressure measurements)

  • Genotype-Phenotype Correlation:

    • Compare clinical parameters (e.g., plasma renin levels) between different genotype groups

    • Establish statistical significance of any observed differences

    • Account for potential confounding variables through multivariate analysis

  • Functional Validation:

    • Construct reporter gene assays to measure the impact of variants on gene expression

    • Design promoter-luciferase constructs containing wild-type or variant sequences

    • Quantify and statistically analyze differences in expression levels

  • Replication Studies:

    • Validate findings in independent populations

    • Consider different ethnic backgrounds to assess universality of associations

    • Meta-analysis of multiple studies to increase statistical power

  • Mechanistic Studies:

    • Investigate how identified variants affect protein function

    • Explore downstream signaling pathways

    • Develop cellular or animal models expressing the variants of interest

What are the critical factors in designing promoter-luciferase assays for GJA5 expression studies?

When designing promoter-luciferase assays to study GJA5 expression:

  • Promoter Fragment Selection:

    • Choose appropriate promoter regions containing regulatory elements of interest

    • For GJA5, an 859-bp promoter fragment (from -765 bp to +94 bp relative to exon 1B) has been successfully used

    • Include regions with SNPs of interest (e.g., rs10465885 -26A>G)

  • Cloning Strategy:

    • Design primers with restriction enzyme sites for directional cloning

    • Amplify promoter fragments from genomic DNA of subjects with different genotypes

    • Clone fragments into appropriate luciferase reporter vectors

  • Transfection Protocol:

    • Select cell lines relevant to GJA5 biology

    • Optimize transfection conditions for consistent efficiency

    • Include internal control reporters (e.g., Renilla luciferase) for normalization

  • Data Analysis:

    • Calculate normalized luciferase activity ratios

    • Apply appropriate statistical tests to determine significance

    • Compare results between wild-type and variant promoters under various conditions

Published studies have demonstrated that the -26A>G variant in the GJA5 promoter significantly reduces promoter activity (165.67±16.85 vs 61.53±8.67, P=0.0007), providing mechanistic insight into its association with essential hypertension .

What purification strategies yield the highest quality recombinant GJA5 protein?

Purification of high-quality recombinant GJA5 requires specific strategies for membrane proteins:

  • Affinity Chromatography:

    • One-step Strep-tag purification for proteins expressed in cell-free systems

    • His-tag purification using immobilized metal affinity chromatography (IMAC)

    • Selection of tag based on downstream applications

  • Quality Control:

    • SDS-PAGE and Western blotting to confirm identity and estimate purity

    • Analytical SEC (size exclusion chromatography) to assess homogeneity

    • Expected purity levels: >70-80% for cell-free systems, >90% for mammalian expression, >95% for bacterial systems optimized for membrane proteins

  • Storage Conditions:

    • Standard storage buffer: PBS pH 7.4 with 10% glycerol

    • Store at -80°C for long-term preservation

    • Avoid repeated freeze-thaw cycles

  • Application-Specific Considerations:

    • For structural studies: Additional purification steps to achieve >95% purity

    • For functional studies: Preservation of native conformation and activity

    • For immunological applications: Verification of antigenic epitope accessibility

How can researchers address challenges in studying GJA5's role in cardiac arrhythmias?

Studying GJA5's role in cardiac arrhythmias presents several challenges requiring specific methodological approaches:

  • Model System Selection:

    • Primary cardiac cells maintain physiological relevance but have limited availability

    • iPSC-derived cardiomyocytes offer patient-specific models

    • Heterologous expression systems provide controlled conditions but may lack cardiac-specific factors

  • Genetic Manipulation Strategies:

    • CRISPR-Cas9 for precise genome editing to introduce or correct GJA5 variants

    • Adenoviral or lentiviral vectors for efficient gene transfer in cardiac cells

    • Inducible expression systems to control timing and level of GJA5 expression

  • Functional Readouts:

    • Multi-electrode arrays for measuring conduction properties in cell monolayers

    • Optical mapping with voltage-sensitive dyes to visualize action potential propagation

    • Patch-clamp electrophysiology for direct measurement of gap junction conductance

  • Integrative Approaches:

    • Combine molecular, cellular, and physiological data to understand system-level effects

    • Correlate in vitro findings with clinical observations

    • Develop computational models to predict arrhythmogenic mechanisms

  • Translational Considerations:

    • Design studies that bridge basic research and clinical applications

    • Consider the polygenic nature of most cardiac arrhythmias

    • Account for environmental factors that modify GJA5 expression and function

How can modern genomic approaches enhance our understanding of GJA5 regulation?

Cutting-edge genomic approaches offer new insights into GJA5 regulation:

  • ChIP-seq Analysis:

    • Identify transcription factors binding to GJA5 regulatory regions

    • Map enhancer elements that control tissue-specific expression

    • Compare binding patterns between normal and pathological conditions

  • CRISPR Screening:

    • Systematically disrupt potential regulatory elements

    • Quantify effects on GJA5 expression

    • Identify novel regulatory networks

  • Single-cell RNA-seq:

    • Profile GJA5 expression heterogeneity across cardiac cell populations

    • Correlate expression patterns with cell-specific functions

    • Identify co-regulated gene networks

  • Epigenetic Profiling:

    • Map DNA methylation patterns in GJA5 regulatory regions

    • Characterize histone modifications associated with active/inactive states

    • Investigate chromatin accessibility changes in disease states

These approaches can reveal how genetic variants like rs10465885 affect GJA5 expression through altered transcription factor binding or epigenetic modifications .

What methodologies can detect functional interactions between GJA5 and other connexins?

Investigating functional interactions between GJA5 and other connexins requires specialized techniques:

  • Co-immunoprecipitation and Proximity Labeling:

    • Pull-down experiments to identify physical interactions

    • BioID or APEX2 proximity labeling to map protein neighborhoods

    • Mass spectrometry to identify interaction partners

  • FRET/BRET Analysis:

    • Fusion proteins with appropriate fluorescent/luminescent tags

    • Real-time monitoring of protein-protein interactions

    • Quantitative measurement of interaction dynamics

  • Electrophysiological Characterization:

    • Patch-clamp analysis of cells expressing multiple connexin types

    • Measurement of channel properties in homotypic vs. heterotypic configurations

    • Pharmacological manipulation to distinguish connexin contributions

  • Fluorescence-based Functional Assays:

    • Dye transfer studies with connexin-specific inhibitors

    • FRAP (Fluorescence Recovery After Photobleaching) to measure gap junction permeability

    • Calcium wave propagation analysis in co-expression systems

  • Super-resolution Microscopy:

    • Visualization of connexin co-localization at nanometer resolution

    • Quantification of heteromeric channel formation

    • Analysis of gap junction plaque composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.